• Gene id: 6941

Gene Summary

• Gene Symbol: TCF19   Gene   UCSC   Ensembl
• Aliases: SC1, TCF-19
• Gene name: transcription factor 19
• Alternate names: transcription factor 19, transcription factor SC1,
• Gene location: 6p21.33 (31158588: 31164214)     Exons: 5     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein that contains a PHD-type zinc finger domain and likely functions as a transcription factor. The encoded protein plays a role proliferation and apoptosis of pancreatic beta cells. Alternative splicing results in multiple transcr
• OMIM: 612490

Protein Summary

• Protein general information: Q9Y242  
  • Name: Transcription factor 19 (TCF 19) (Transcription factor SC1)
  • Length: 345  
  • Mass: 37184
• Sequence:

  MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLED
  HSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFMFQQVRVKPQDFAAITIPRSRGEARVGAGFR
  PMLPSQGAPQRPLSTFSPAPKATLILNSIGSLSKLRPQPLTFSPSWGGPKSLPVPAPPGEMGTTPSAPPQRNRRK
  SVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAPMAPPAVGGGEPCAAPCCCLP
  QEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT

• Structural information:
  • Protein Domains: (31..8-)
    (/note="FHA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00086"-)
  • Interpro: IPR000253  IPR008984  IPR042803  IPR039095  IPR019786   IPR011011  IPR001965  IPR013083  
  • Prosite: PS50006 PS01359
  • CDD: cd00060 cd15609
  • STRING: ENSP00000365433
• Other Databases: GeneCards:  TCF19  Malacards:  TCF19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0010468	regulation of gene expression	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881