• Gene id: 6932

Gene Summary

• Gene Symbol: TCF7   Gene   UCSC   Ensembl
• Aliases: TCF-1
• Gene name: transcription factor 7
• Alternate names: transcription factor 7, T-cell-factor-7, T-cell-specific transcription factor 1, transcription factor 7 (T-cell specific, HMG-box),
• Gene location: 5q31.1 (134114680: 134148228)     Exons: 18     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the T-cell factor/lymphoid enhancer-binding factor family of high mobility group (HMG) box transcriptional activators. This gene is expressed predominantly in T-cells and plays a critical role in natural killer cell and innat
• OMIM: 189908

Protein Summary

• Protein general information: P36402  
  • Name: Transcription factor 7 (TCF 7) (T cell specific transcription factor 1) (T cell factor 1) (TCF 1)
  • Length: 384  
  • Mass: 41642
  • Tissue specificity: Predominantly expressed in T-cells. Also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. {ECO
• Sequence:

  MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAG
  AGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKA
  NQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVP
  GHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAIN
  QILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESL
  SMSSSSSPA

• Structural information:
  • Interpro: IPR027397  IPR013558  IPR009071  IPR036910  IPR024940   IPR028785  
  • Prosite: PS50118
  • STRING: ENSP00000340347
• Other Databases: GeneCards:  TCF7  Malacards:  TCF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0008013	beta-catenin binding	IBA	molecular function
GO:0016055	Wnt signaling pathway	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0033153	T cell receptor V(D)J recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046632	alpha-beta T cell differentiation	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0033153	T cell receptor V(D)J recombination	IEA	biological process
GO:0021915	neural tube development	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0001217	DNA-binding transcription repressor activity	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0048619	embryonic hindgut morphogenesis	IEA	biological process
GO:0048557	embryonic digestive tract morphogenesis	IEA	biological process
GO:0045586	regulation of gamma-delta T cell differentiation	IEA	biological process
GO:0044336	canonical Wnt signaling pathway involved in negative regulation of apoptotic process	IEA	biological process
GO:0030538	embryonic genitalia morphogenesis	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005719	nuclear euchromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0071353	cellular response to interleukin-4	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001217	DNA-binding transcription repressor activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0045586	regulation of gamma-delta T cell differentiation	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05165	Human papillomavirus infection
hsa05132	Salmonella infection
hsa04310	Wnt signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05210	Colorectal cancer
hsa05215	Prostate cancer
hsa05217	Basal cell carcinoma
hsa04520	Adherens junction
hsa05221	Acute myeloid leukemia
hsa05213	Endometrial cancer
hsa05216	Thyroid cancer

Diseases

Associated diseases	References
Prostate cancer	PMID:28220803
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray