• Gene id: 6923

Gene Summary

• Gene Symbol: ELOB   Gene   UCSC   Ensembl
• Aliases: SIII, TCEB2
• Gene name: elongin B
• Alternate names: elongin-B, RNA polymerase II transcription factor SIII p18 subunit, RNA polymerase II transcription factor SIII subunit B, SIII p18, elongin 18 kDa subunit, elongin, 18-kD subunit, epididymis secretory sperm binding protein, transcription elongation factor B (SI,
• Gene location: 16p13.3 (2777279: 2771413)     Exons: 16     NC_000016.10
• Gene summary(Entrez): This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymera
• OMIM: 600787

Protein Summary

• Protein general information: Q15370  
  • Name: Elongin B (EloB) (Elongin 18 kDa subunit) (RNA polymerase II transcription factor SIII subunit B) (SIII p18) (Transcription elongation factor B polypeptide 2)
  • Length: 118  
  • Mass: 13133
• Sequence:

  MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATV
  GLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

• Structural information:
  • Protein Domains: (1..6-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR039049  IPR000626  IPR029071  
  • Prosite: PS50053
  • PDB: 1LM8 1LQB 1VCB 2C9W 2IZV 2JZ3 2MA9 3DCG 3ZKJ 3ZNG 3ZRC 3ZRF 3ZTC 3ZTD 3ZUN 4AJY 4AWJ 4B95 4B9K 4BKS 4BKT 4N9F 4W9C 4W9D 4W9E 4W9F 4W9G 4W9H 4W9I 4W9J 4W9K 4W9L 4WQO 5BO4 5LLI 5N4W 5NVV 5NVW 5NVX 5NVY 5NVZ 5NW0 5NW1 5NW2 5T35 6BVB 6C5X 6FMI 6FMJ 6FMK 6GFX 6GFY 6GFZ 6GMN 6GMQ 6GMR 6GMX 6HAX 6HAY 6HR2 6I4X 6I5J 6I5N 6I7
  • PDBsum: 1LM8 1LQB 1VCB 2C9W 2IZV 2JZ3 2MA9 3DCG 3ZKJ 3ZNG 3ZRC 3ZRF 3ZTC 3ZTD 3ZUN 4AJY 4AWJ 4B95 4B9K 4BKS 4BKT 4N9F 4W9C 4W9D 4W9E 4W9F 4W9G 4W9H 4W9I 4W9J 4W9K 4W9L 4WQO 5BO4 5LLI 5N4W 5NVV 5NVW 5NVX 5NVY 5NVZ 5NW0 5NW1 5NW2 5T35 6BVB 6C5X 6FMI 6FMJ 6FMK 6GFX 6GFY 6GFZ 6GMN 6GMQ 6GMR 6GMX 6HAX 6HAY 6HR2 6I4X 6I5J 6I5N 6I7
  • DIP: 29570
  • STRING: ENSP00000262306
• Other Databases: GeneCards:  ELOB  Malacards:  ELOB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030891	VCB complex	IBA	cellular component
GO:0070449	elongin complex	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030891	VCB complex	IEA	cellular component
GO:0070449	elongin complex	IEA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0031462	Cul2-RING ubiquitin ligase complex	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0031466	Cul5-RING ubiquitin ligase complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05170	Human immunodeficiency virus 1 infection
hsa04120	Ubiquitin mediated proteolysis
hsa04066	HIF-1 signaling pathway
hsa05211	Renal cell carcinoma

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray