• Gene id: 6915

Gene Summary

• Gene Symbol: TBXA2R   Gene   UCSC   Ensembl
• Aliases: BDPLT13, TXA2-R
• Gene name: thromboxane A2 receptor
• Alternate names: thromboxane A2 receptor, prostanoid TP receptor,
• Gene location: 19p13.3 (3608748: 3594506)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the G protein-coupled receptor family. The protein interacts with thromboxane A2 to induce platelet aggregation and regulate hemostasis. A mutation in this gene results in a bleeding disorder. Multiple transcript variants enc

Protein Summary

• Protein general information: P21731  
  • Name: Thromboxane A2 receptor (TXA2 R) (Prostanoid TP receptor)
  • Length: 343  
  • Mass: 37431
• Sequence:

  MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDF
  LGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAW
  ATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHV
  YHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
  QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR008365  IPR001105  
  • Prosite: PS00237 PS50262
  • PDB: 1LBN
  • PDBsum: 1LBN
  • DIP: 41465
  • STRING: ENSP00000393333
• Other Databases: GeneCards:  TBXA2R  Malacards:  TBXA2R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045777	positive regulation of blood pressure	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004961	thromboxane A2 receptor activity	IBA	molecular function
GO:0045907	positive regulation of vasoconstriction	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004960	thromboxane receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004961	thromboxane A2 receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004960	thromboxane receptor activity	IEA	molecular function
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0004960	thromboxane receptor activity	IEA	molecular function
GO:0007584	response to nutrient	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0019229	regulation of vasoconstriction	IEA	biological process
GO:0019932	second-messenger-mediated signaling	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0030194	positive regulation of blood coagulation	IEA	biological process
GO:0033574	response to testosterone	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IGI	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0038193	thromboxane A2 signaling pathway	IEA	biological process
GO:0038193	thromboxane A2 signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04611	Platelet activation

Diseases

Associated diseases	References
Bleeding disorder platelet-type	KEGG:H01235
Bleeding disorder platelet-type	KEGG:H01235
blood platelet disease	PMID:7929844
Asthma	PMID:12000493
Asthma	PMID:15805995
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray