• Gene id: 6902

Gene Summary

• Gene Symbol: TBCA   Gene   UCSC   Ensembl
• Gene name: tubulin folding cofactor A
• Alternate names: tubulin-specific chaperone A, CFA, TCP1-chaperonin cofactor A, chaperonin cofactor A, epididymis secretory sperm binding protein,
• Gene location: 5q14.1 (77776360: 77691165)     Exons: 10     NC_000005.10
• Gene summary(Entrez): The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubuli
• OMIM: 610058

Protein Summary

• Protein general information: O75347  
  • Name: Tubulin specific chaperone A (TCP1 chaperonin cofactor A) (Tubulin folding cofactor A) (CFA)
  • Length: 108  
  • Mass: 12855
• Sequence:

  MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAY
  LDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

• Structural information:
  • Interpro: IPR004226  IPR036126  
  • PDB: 1H7C
  • PDBsum: 1H7C
  • STRING: ENSP00000306362
• Other Databases: GeneCards:  TBCA  Malacards:  TBCA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007021	tubulin complex assembly	IBA	biological process
GO:0015631	tubulin binding	IBA	molecular function
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0007021	tubulin complex assembly	IEA	biological process
GO:0007023	post-chaperonin tubulin folding pathway	IEA	biological process
GO:0048487	beta-tubulin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051087	chaperone binding	TAS	molecular function
GO:0007023	post-chaperonin tubulin folding pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005737	cytoplasm	TAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray