• Gene id: 6897

Gene Summary

• Gene Symbol: TARS1   Gene   UCSC   Ensembl
• Aliases: TARS, TTD7, ThrRS
• Gene name: threonyl-tRNA synthetase 1
• Alternate names: threonine--tRNA ligase 1, cytoplasmic, threonine tRNA ligase 1, cytoplasmic, threonine--tRNA ligase, cytoplasmic, threonyl-tRNA synthetase, cytoplasmic,
• Gene location: 5p13.3 (33440695: 33468090)     Exons: 21     NC_000005.10
• Gene summary(Entrez): Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first prot
• OMIM: 187790

Protein Summary

• Protein general information: P26639  
  • Name: Threonine tRNA ligase 1, cytoplasmic (EC 6.1.1.3) (Threonyl tRNA synthetase) (ThrRS) (Threonyl tRNA synthetase 1)
  • Length: 723  
  • Mass: 83435
• Sequence:

  MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNILKAEHDSILAEK
  AEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQ
  AVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKET
  LLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGI
  SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTP
  NIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALT
  GLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNE
  FGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERM
  IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILV
  VGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEF

• Structural information:
  • Protein Domains: (79..14-)
    (/note="TGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01228"-)
  • Interpro: IPR002314  IPR006195  IPR004154  IPR036621  IPR012675   IPR004095  IPR012676  IPR002320  IPR018163  IPR033728  IPR012947  
  • Prosite: PS50862 PS51880
  • CDD: cd00771
  • PDB: 1WWT 4HWT 4P3N 4TTV 5XLN
  • PDBsum: 1WWT 4HWT 4P3N 4TTV 5XLN
  • STRING: ENSP00000387710
• Other Databases: GeneCards:  TARS1  Malacards:  TARS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006418	tRNA aminoacylation for protein translation	IBA	biological process
GO:0004829	threonine-tRNA ligase activity	IBA	molecular function
GO:0004812	aminoacyl-tRNA ligase activity	IBA	molecular function
GO:0006435	threonyl-tRNA aminoacylation	IBA	biological process
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0004829	threonine-tRNA ligase activity	IEA	molecular function
GO:0006418	tRNA aminoacylation for protein translation	IEA	biological process
GO:0043039	tRNA aminoacylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006435	threonyl-tRNA aminoacylation	IEA	biological process
GO:0000049	tRNA binding	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004829	threonine-tRNA ligase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006435	threonyl-tRNA aminoacylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004829	threonine-tRNA ligase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0006435	threonyl-tRNA aminoacylation	IDA	biological process
GO:0004829	threonine-tRNA ligase activity	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005524	ATP binding	IMP	molecular function
GO:0004829	threonine-tRNA ligase activity	ISS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0006435	threonyl-tRNA aminoacylation	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)