• Gene id: 6895

Gene Summary

• Gene Symbol: TARBP2   Gene   UCSC   Ensembl
• Aliases: LOQS, TRBP, TRBP1, TRBP2
• Gene name: TARBP2 subunit of RISC loading complex
• Alternate names: RISC-loading complex subunit TARBP2, TAR (HIV) RNA-binding protein 2, TAR (HIV) RNA-binding protein TRBP1, TAR (HIV-1) RNA binding protein 2, TAR RNA binding protein 2, TARBP2, RISC loading complex RNA binding subunit, trans-activation responsive RNA-binding pr,
• Gene location: 12q13.13 (53500920: 53506430)     Exons: 11     NC_000012.12
• Gene summary(Entrez): HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA
• OMIM: 605053

Protein Summary

• Protein general information: Q15633  
  • Name: RISC loading complex subunit TARBP2 (TAR RNA binding protein 2) (Trans activation responsive RNA binding protein)
  • Length: 366  
  • Mass: 39039
• Sequence:

  MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTG
  QGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAATPVPSVVLTRSPPMELQPP
  VSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRV
  HTVPLDARDGNEVEPDDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE
  LSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLKIMAGSK

• Structural information:
  • Protein Domains: (30..9-)
    (/note="DRBM-1)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03034-)
    (159..22-)
    (/note="DRBM-2)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03034-)
    (293..36-)
    (/note="DRBM-3)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03034"-)
  • Interpro: IPR014720  IPR028605  
  • Prosite: PS50137
  • CDD: cd00048
  • PDB: 2CPN 3ADL 3LLH 4WYQ 5N8L 5N8M 5ZAK 5ZAL 5ZAM
  • PDBsum: 2CPN 3ADL 3LLH 4WYQ 5N8L 5N8M 5ZAK 5ZAL 5ZAM
  • DIP: 29665
  • STRING: ENSP00000266987
• Other Databases: GeneCards:  TARBP2  Malacards:  TARBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035087	siRNA loading onto RISC involved in RNA interference	IDA	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0016442	RISC complex	IDA	cellular component
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035197	siRNA binding	IEA	molecular function
GO:1903798	regulation of production of miRNAs involved in gene silencing by miRNA	IEA	biological process
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0046782	regulation of viral transcription	IEA	biological process
GO:0070578	RISC-loading complex	IEA	cellular component
GO:0070883	pre-miRNA binding	IEA	molecular function
GO:0090065	regulation of production of siRNA involved in RNA interference	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010586	miRNA metabolic process	TAS	biological process
GO:0030422	production of siRNA involved in RNA interference	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903798	regulation of production of miRNAs involved in gene silencing by miRNA	IEA	biological process
GO:0051149	positive regulation of muscle cell differentiation	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0007338	single fertilization	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0061351	neural precursor cell proliferation	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0016442	RISC complex	IEA	cellular component
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0036002	pre-mRNA binding	TAS	molecular function
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0070883	pre-miRNA binding	IDA	contributes to
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0035280	miRNA loading onto RISC involved in gene silencing by miRNA	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0035197	siRNA binding	IEA	molecular function
GO:0035198	miRNA binding	IEA	molecular function
GO:0030422	production of siRNA involved in RNA interference	IEA	biological process
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0035280	miRNA loading onto RISC involved in gene silencing by miRNA	IEA	biological process
GO:0031054	pre-miRNA processing	IEA	biological process
GO:0016442	RISC complex	IEA	cellular component
GO:0050689	negative regulation of defense response to virus by host	IDA	biological process
GO:0045070	positive regulation of viral genome replication	IDA	biological process
GO:0035197	siRNA binding	IDA	molecular function
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0046782	regulation of viral transcription	IDA	biological process
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IMP	biological process
GO:0006469	negative regulation of protein kinase activity	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881