• Gene id: 6888

Gene Summary

• Gene Symbol: TALDO1   Gene   UCSC   Ensembl
• Aliases: TAL, TAL-H, TALDOR, TALH
• Gene name: transaldolase 1
• Alternate names: transaldolase, dihydroxyacetone transferase, glycerone transferase, testicular secretory protein Li 56,
• Gene location: 11p15.5 (747463: 765011)     Exons: 8     NC_000011.10
• Gene summary(Entrez): Transaldolase 1 is a key enzyme of the nonoxidative pentose phosphate pathway providing ribose-5-phosphate for nucleic acid synthesis and NADPH for lipid biosynthesis. This pathway can also maintain glutathione at a reduced state and thus protect sulfhydr
• OMIM: 602063

Protein Summary

• Protein general information: P37837  
  • Name: Transaldolase (EC 2.2.1.2)
  • Length: 337  
  • Mass: 37540
• Sequence:

  MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGS
  QEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGI
  QAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYK
  KFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNE
  DQMAVEKLSDGIRKFAADAVKLERMLTERMFNAENGK

• Structural information:
  • Interpro: IPR013785  IPR001585  IPR004730  IPR018225  
  • Prosite: PS01054 PS00958
  • CDD: cd00957
  • PDB: 1F05
  • PDBsum: 1F05
  • STRING: ENSP00000321259
• Other Databases: GeneCards:  TALDO1  Malacards:  TALDO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009052	pentose-phosphate shunt, non-oxidative branch	IBA	biological process
GO:0004801	sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity	IBA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0006098	pentose-phosphate shunt	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004801	sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006098	pentose-phosphate shunt	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004801	sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity	TAS	molecular function
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0004801	sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005999	xylulose biosynthetic process	TAS	biological process
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006098	pentose-phosphate shunt	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0019682	glyceraldehyde-3-phosphate metabolic process	IEA	biological process
GO:0009052	pentose-phosphate shunt, non-oxidative branch	IEA	biological process
GO:0006098	pentose-phosphate shunt	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0048029	monosaccharide binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0006002	fructose 6-phosphate metabolic process	IEA	biological process
GO:0004801	sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006098	pentose-phosphate shunt	IEA	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00030	Pentose phosphate pathway

Diseases

Associated diseases	References
Transaldolase deficiency	KEGG:H01189
Transaldolase deficiency	KEGG:H01189
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881