• Gene id: 6887

Gene Summary

• Gene Symbol: TAL2   Gene   UCSC   Ensembl
• Gene name: TAL bHLH transcription factor 2
• Alternate names: T-cell acute lymphocytic leukemia protein 2, T-cell acute lymphocytic leukemia 2, TAL-2, class A basic helix-loop-helix protein 19,
• Gene location: 9q31.2 (105662456: 105663123)     Exons: 1     NC_000009.12
• Gene summary(Entrez): This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-c
• OMIM: 607050

Protein Summary

• Protein general information: Q16559  
  • Name: T cell acute lymphocytic leukemia protein 2 (TAL 2) (Class A basic helix loop helix protein 19) (bHLHa19)
  • Length: 108  
  • Mass: 12291
• Sequence:

  MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNIL
  GLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP

• Structural information:
  • Protein Domains: (2..5-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR036638  IPR040238  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000334547
• Other Databases: GeneCards:  TAL2  Malacards:  TAL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021794	thalamus development	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0030901	midbrain development	IEA	biological process

Diseases

Associated diseases	References
Adult T-cell leukemia	PMID:1763056
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881