• Gene id: 6885

Gene Summary

• Gene Symbol: MAP3K7   Gene   UCSC   Ensembl
• Aliases: CSCF, FMD2, MEKK7, TAK1, TGF1a
• Gene name: mitogen-activated protein kinase kinase kinase 7
• Alternate names: mitogen-activated protein kinase kinase kinase 7, TGF-beta activated kinase 1, transforming growth factor-beta-activated kinase 1,
• Gene location: 6q15 (90587071: 90513578)     Exons: 17     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcripti
• OMIM: 602614

Protein Summary

• Protein general information: O43318  
  • Name: Mitogen activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor beta activated kinase 1) (TGF beta activated kinase 1)
  • Length: 606  
  • Mass: 67196
  • Tissue specificity: Isoform 1A is the most abundant in ovary, skeletal muscle, spleen and blood mononuclear cells. Isoform 1B is highly expressed in brain, kidney and small intestine. Isoform 1C is the major form in prostate. Isoform 1D is the less abunda
• Sequence:

  MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFI
  VELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPK
  ALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITR
  RKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
  PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLSLGASRGSS
  VESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEP
  GQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQ
  HCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
  KRQGTS

• Structural information:
  • Protein Domains: (36..29-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR017421  IPR000719  IPR017441  IPR001245   IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2EVA 2YIY 4GS6 4L3P 4L52 4L53 4O91 5E7R 5GJD 5GJF 5GJG 5J7S 5J8I 5J9L 5JGA 5JGB 5JGD 5JH6 5JK3 5V5N
  • PDBsum: 2EVA 2YIY 4GS6 4L3P 4L52 4L53 4O91 5E7R 5GJD 5GJF 5GJG 5J7S 5J8I 5J9L 5JGA 5JGB 5JGD 5JH6 5JK3 5V5N
  • DIP: 27523
  • STRING: ENSP00000358335
• Other Databases: GeneCards:  MAP3K7  Malacards:  MAP3K7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0007254	JNK cascade	IBA	biological process
GO:0004709	MAP kinase kinase kinase activity	IBA	molecular function
GO:0051403	stress-activated MAPK cascade	IDA	biological process
GO:0007254	JNK cascade	IDA	biological process
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0004709	MAP kinase kinase kinase activity	IDA	molecular function
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0043507	positive regulation of JUN kinase activity	IDA	biological process
GO:0000186	activation of MAPKK activity	IDA	biological process
GO:0000186	activation of MAPKK activity	IDA	biological process
GO:0008385	IkappaB kinase complex	IPI	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004709	MAP kinase kinase kinase activity	TAS	molecular function
GO:0007179	transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0097110	scaffold protein binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004709	MAP kinase kinase kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007254	JNK cascade	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0016239	positive regulation of macroautophagy	ISS	biological process
GO:0043276	anoikis	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007250	activation of NF-kappaB-inducing kinase activity	IMP	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IMP	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0050852	T cell receptor signaling pathway	NAS	biological process
GO:0043507	positive regulation of JUN kinase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0032743	positive regulation of interleukin-2 production	IMP	biological process
GO:0002726	positive regulation of T cell cytokine production	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04010	MAPK signaling pathway
hsa05131	Shigellosis
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04310	Wnt signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04140	Autophagy - animal
hsa05161	Hepatitis B
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04152	AMPK signaling pathway
hsa05162	Measles
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa04657	IL-17 signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04520	Adherens junction
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Cardiospondylocarpofacial syndrome	KEGG:H02226
Frontometaphyseal dysplasia	KEGG:H02227
Cardiospondylocarpofacial syndrome	KEGG:H02226
Frontometaphyseal dysplasia	KEGG:H02227
Prostate cancer	PMID:17785553
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)