• Gene id: 6884

Gene Summary

• Gene Symbol: TAF13   Gene   UCSC   Ensembl
• Aliases: MRT60, TAF(II)18, TAF2K, TAFII-18, TAFII18
• Gene name: TATA-box binding protein associated factor 13
• Alternate names: transcription initiation factor TFIID subunit 13, TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa, TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD, transcription initiation factor TFIID 18 kD subu,
• Gene location: 1p13.3 (25906876: 25884178)     Exons: 8     NC_000001.11
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 600774

Protein Summary

• Protein general information: Q15543  
  • Name: Transcription initiation factor TFIID subunit 13 (Transcription initiation factor TFIID 18 kDa subunit) (TAF(II)18) (TAFII 18) (TAFII18)
  • Length: 124  
  • Mass: 14287
• Sequence:

  MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSI
  GRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

• Structural information:
  • Protein Domains: (31..7-)
    (/note="Histone-fold-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR009072  IPR003195  
  • CDD: cd07978
  • PDB: 1BH8 1BH9 6MZD 6MZL
  • PDBsum: 1BH8 1BH9 6MZD 6MZL
  • DIP: 900
  • STRING: ENSP00000355051
• Other Databases: GeneCards:  TAF13  Malacards:  TAF13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IC	molecular function
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0003677	DNA binding	IBA	molecular function
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IC	biological process
GO:0006366	transcription by RNA polymerase II	IC	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0006352	DNA-templated transcription, initiation	NAS	biological process
GO:0005669	transcription factor TFIID complex	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Autosomal recessive mental retardation	KEGG:H00768
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881