• Gene id: 6883

Gene Summary

• Gene Symbol: TAF12   Gene   UCSC   Ensembl
• Aliases: TAF2J, TAFII20
• Gene name: TATA-box binding protein associated factor 12
• Alternate names: transcription initiation factor TFIID subunit 12, TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa, TAFII-20/TAFII-15, TAFII20/TAFII15, TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD, transcription ,
• Gene location: 1p35.3 (28648706: 28602849)     Exons: 8     NC_000001.11
• Gene summary(Entrez): Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regu
• OMIM: 600773

Protein Summary

• Protein general information: Q16514  
  • Name: Transcription initiation factor TFIID subunit 12 (Transcription initiation factor TFIID 20/15 kDa subunits) (TAFII 20/TAFII 15) (TAFII20/TAFII15)
  • Length: 161  
  • Mass: 17924
  • Tissue specificity: Ubiquitous.
• Sequence:

  MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQ
  LDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQ
  RMALIRKTTKK

• Structural information:
  • Protein Domains: (59..12-)
    (/note="Histone-fold-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR009072  IPR037794  IPR003228  
  • CDD: cd07981
  • PDB: 1H3O 6MZC 6MZD 6MZL 6MZM
  • PDBsum: 1H3O 6MZC 6MZD 6MZL 6MZM
  • DIP: 496
  • STRING: ENSP00000263974
• Other Databases: GeneCards:  TAF12  Malacards:  TAF12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0017025	TBP-class protein binding	IBA	molecular function
GO:0051123	RNA polymerase II preinitiation complex assembly	IBA	biological process
GO:0005669	transcription factor TFIID complex	IEA	cellular component
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0000124	SAGA complex	IEA	cellular component
GO:0046695	SLIK (SAGA-like) complex	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005669	transcription factor TFIID complex	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030914	STAGA complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0006352	DNA-templated transcription, initiation	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0008134	transcription factor binding	IDA	molecular function
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0030914	STAGA complex	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	contributes to
GO:0003677	DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq