• Gene id: 6882

Gene Summary

• Gene Symbol: TAF11   Gene   UCSC   Ensembl
• Aliases: MGC:15243, PRO2134, TAF2I, TAFII28
• Gene name: TATA-box binding protein associated factor 11
• Alternate names: transcription initiation factor TFIID subunit 11, TAF(II)28, TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa, TAFII-28, TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD, TFIID subunit p30-beta, transc,
• Gene location: 6p21.31 (34888070: 34877461)     Exons: 6     NC_000006.12
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 600772

Protein Summary

• Protein general information: Q15544  
  • Name: Transcription initiation factor TFIID subunit 11 (TFIID subunit p30 beta) (Transcription initiation factor TFIID 28 kDa subunit) (TAF(II)28) (TAFII 28) (TAFII28)
  • Length: 211  
  • Mass: 23307
• Sequence:

  MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVEREDSS
  LLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNV
  VIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF

• Structural information:
  • Interpro: IPR009072  IPR006809  
  • CDD: cd08048
  • PDB: 1BH8 1BH9 6MZD 6MZL
  • PDBsum: 1BH8 1BH9 6MZD 6MZL
  • DIP: 495
  • STRING: ENSP00000354633
• Other Databases: GeneCards:  TAF11  Malacards:  TAF11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IC	molecular function
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0051123	RNA polymerase II preinitiation complex assembly	IBA	biological process
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0006367	transcription initiation from RNA polymerase II promoter	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0043923	positive regulation by host of viral transcription	IDA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IC	biological process
GO:0006366	transcription by RNA polymerase II	IC	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0046966	thyroid hormone receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042809	vitamin D receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray