• Gene id: 6881

Gene Summary

• Gene Symbol: TAF10   Gene   UCSC   Ensembl
• Aliases: TAF2A, TAF2H, TAFII30
• Gene name: TATA-box binding protein associated factor 10
• Alternate names: transcription initiation factor TFIID subunit 10, STAF28, TAF(II)30, TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa, TAFII-30, TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30kD, transcription initiati,
• Gene location: 11p15.4 (6612215: 6606293)     Exons: 5     NC_000011.10
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 600475

Protein Summary

• Protein general information: Q12962  
  • Name: Transcription initiation factor TFIID subunit 10 (STAF28) (Transcription initiation factor TFIID 30 kDa subunit) (TAF(II)30) (TAFII 30) (TAFII30)
  • Length: 218  
  • Mass: 21711
• Sequence:

  MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERR
  GAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPR
  IIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

• Structural information:
  • Interpro: IPR003923  
  • CDD: cd07982
  • PDB: 2F69 3M53 3M54 3M55 3M56 3M57 3M58 3M59 3M5A 4J7F 4J7I 4J83 4J8O 4WV4 5EG2 6MZC 6MZD 6MZL 6MZM
  • PDBsum: 2F69 3M53 3M54 3M55 3M56 3M57 3M58 3M59 3M5A 4J7F 4J7I 4J83 4J8O 4WV4 5EG2 6MZC 6MZD 6MZL 6MZM
  • DIP: 297
  • STRING: ENSP00000299424
• Other Databases: GeneCards:  TAF10  Malacards:  TAF10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990841	promoter-specific chromatin binding	IEA	molecular function
GO:0051101	regulation of DNA binding	IEA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IEA	biological process
GO:0070365	hepatocyte differentiation	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0034622	cellular protein-containing complex assembly	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0070063	RNA polymerase binding	IDA	molecular function
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IC	biological process
GO:0006366	transcription by RNA polymerase II	IC	biological process
GO:0006352	DNA-templated transcription, initiation	IDA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0030914	STAGA complex	IDA	cellular component
GO:0030331	estrogen receptor binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	contributes to
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0016578	histone deubiquitination	IDA	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0006352	DNA-templated transcription, initiation	IDA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0000125	PCAF complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Oligozoospermia	MIK: 21989496
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
21989496	Oligozoospermia			11 (8 infertile and 3 fertile men)	Male infertility	Microarray