• Gene id: 6880

Gene Summary

• Gene Symbol: TAF9   Gene   UCSC   Ensembl
• Aliases: MGC:5067, STAF31/32, TAF2G, TAFII-31, TAFII-32, TAFII31, TAFII32, TAFIID32
• Gene name: TATA-box binding protein associated factor 9
• Alternate names: transcription initiation factor TFIID subunit 9, RNA polymerase II TBP-associated factor subunit G, TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa, transcription initiation factor TFIID 31 kD subunit, transcription initiation ,
• Gene location: 5q13.2 (69370012: 69364742)     Exons: 4     NC_000005.10
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 603615

Protein Summary

• Protein general information: Q16594  
  • Name: Transcription initiation factor TFIID subunit 9 (RNA polymerase II TBP associated factor subunit G) (STAF31/32) (Transcription initiation factor TFIID 31 kDa subunit) (TAFII 31) (TAFII31) (Transcription initiation factor TFIID 32 kDa subunit) (TAFII 32) (
  • Length: 264  
  • Mass: 28974
• Sequence:

  MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAI
  QCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSV
  GSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNIL
  ITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL

• Structural information:
  • Interpro: IPR009072  IPR003162  
  • CDD: cd07979
  • PDB: 6F3T 6MZC 6MZD 6MZL 6MZM
  • PDBsum: 6F3T 6MZC 6MZD 6MZL 6MZM
  • DIP: 435
  • STRING: ENSP00000370193
• Other Databases: GeneCards:  TAF9  Malacards:  TAF9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IC	molecular function
GO:0006366	transcription by RNA polymerase II	IBA	biological process
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0000124	SAGA complex	IBA	cellular component
GO:0071339	MLL1 complex	IDA	cellular component
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033613	activating transcription factor binding	IPI	molecular function
GO:0033613	activating transcription factor binding	IPI	molecular function
GO:0070742	C2H2 zinc finger domain binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0070761	pre-snoRNP complex	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0060760	positive regulation of response to cytokine stimulus	IMP	biological process
GO:0070555	response to interleukin-1	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IC	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IC	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0000125	PCAF complex	IDA	cellular component
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0030914	STAGA complex	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0000492	box C/D snoRNP assembly	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray