• Gene id: 6879

Gene Summary

• Gene Symbol: TAF7   Gene   UCSC   Ensembl
• Aliases: TAF2F, TAFII55
• Gene name: TATA-box binding protein associated factor 7
• Alternate names: transcription initiation factor TFIID subunit 7, RNA polymerase II TBP-associated factor subunit F, TAF(II)55, TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, TAFII-55, TATA box binding protein (TBP)-associated factor, RNA poly,
• Gene location: 5q31.3 (47426472: 47418768)     Exons: 12     NC_000011.10
• Gene summary(Entrez): The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box i
• OMIM: 600573

Protein Summary

• Protein general information: Q15545  
  • Name: Transcription initiation factor TFIID subunit 7 (RNA polymerase II TBP associated factor subunit F) (Transcription initiation factor TFIID 55 kDa subunit) (TAF(II)55) (TAFII 55) (TAFII55)
  • Length: 349  
  • Mass: 40259
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVME
  SLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRK
  TAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFND
  LSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAK
  RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

• Structural information:
  • Interpro: IPR037817  IPR006751  
  • CDD: cd08047
  • PDB: 4RGW 5FUR 6MZL 6MZM
  • PDBsum: 4RGW 5FUR 6MZL 6MZM
  • DIP: 29047
  • STRING: ENSP00000312709
• Other Databases: GeneCards:  TAF7  Malacards:  TAF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0061628	H3K27me3 modified histone binding	IPI	contributes to
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005667	transcription regulator complex	IPI	cellular component
GO:0045347	negative regulation of MHC class II biosynthetic process	IMP	biological process
GO:0090241	negative regulation of histone H4 acetylation	IDA	biological process
GO:0045344	negative regulation of MHC class I biosynthetic process	IDA	biological process
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0051123	RNA polymerase II preinitiation complex assembly	IBA	biological process
GO:0035035	histone acetyltransferase binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0008134	transcription factor binding	IBA	molecular function
GO:0071339	MLL1 complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IEA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030520	intracellular estrogen receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0035035	histone acetyltransferase binding	IEA	molecular function
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005669	transcription factor TFIID complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0006352	DNA-templated transcription, initiation	IDA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0035067	negative regulation of histone acetylation	IDA	biological process
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0106140	P-TEFb complex binding	IDA	molecular function
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	contributes to
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0001097	TFIIH-class transcription factor complex binding	IDA	molecular function
GO:0042809	vitamin D receptor binding	IPI	molecular function
GO:0000296	spermine transport	ISS	biological process
GO:0046966	thyroid hormone receptor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881