• Gene id: 6878

Gene Summary

• Gene Symbol: TAF6   Gene   UCSC   Ensembl
• Aliases: ALYUS, MGC:8964, TAF(II)70, TAF(II)80, TAF2E, TAFII-70, TAFII-80, TAFII70, TAFII80, TAFII85
• Gene name: TATA-box binding protein associated factor 6
• Alternate names: transcription initiation factor TFIID subunit 6, RNA polymerase II TBP-associated factor subunit E, TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa, TATA box binding protein (TBP)-associated factor, RNA polymerase II, E, 70/85,
• Gene location: 7q22.1 (100127207: 100107069)     Exons: 20     NC_000007.14
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 602955

Protein Summary

• Protein general information: P49848  
  • Name: Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII 70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80)
  • Length: 677  
  • Mass: 72668
• Sequence:

  MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYAL
  KLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPP
  PAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYK
  EITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKY
  VHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYG
  SIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRA
  EFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARA
  AAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGP
  GSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQP
  AP

• Structural information:
  • Interpro: IPR016024  IPR009072  IPR037796  IPR011442  IPR004823  
  • PDB: 5FUR 6F3T 6MZC 6MZD 6MZL 6MZM
  • PDBsum: 5FUR 6F3T 6MZC 6MZD 6MZL 6MZM
  • DIP: 773
  • STRING: ENSP00000399982
• Other Databases: GeneCards:  TAF6  Malacards:  TAF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0000124	SAGA complex	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IBA	contributes to
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IBA	biological process
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0006325	chromatin organization	IBA	biological process
GO:0051123	RNA polymerase II preinitiation complex assembly	IBA	biological process
GO:0071339	MLL1 complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IEA	cellular component
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	IEA	biological process
GO:0000124	SAGA complex	IEA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IEA	molecular function
GO:0046695	SLIK (SAGA-like) complex	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IMP	cellular component
GO:0017162	aryl hydrocarbon receptor binding	IPI	molecular function
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	contributes to
GO:0003677	DNA binding	IDA	molecular function
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0006352	DNA-templated transcription, initiation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006366	transcription by RNA polymerase II	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Wiedemann-Steiner syndrome	KEGG:H01879
Wiedemann-Steiner syndrome	KEGG:H01879
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881