• Gene id: 6877

Gene Summary

• Gene Symbol: TAF5   Gene   UCSC   Ensembl
• Aliases: TAF(II)100, TAF2D, TAFII-100, TAFII100
• Gene name: TATA-box binding protein associated factor 5
• Alternate names: transcription initiation factor TFIID subunit 5, TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa, TATA box binding protein (TBP)-associated factor 2D, TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 10,
• Gene location: 10q24.33 (99919529: 99890402)     Exons: 7     NC_000007.14
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 601787

Protein Summary

• Protein general information: Q15542  
  • Name: Transcription initiation factor TFIID subunit 5 (Transcription initiation factor TFIID 100 kDa subunit) (TAF(II)100) (TAFII 100) (TAFII100)
  • Length: 800  
  • Mass: 86830
• Sequence:

  MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAP
  AGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSR
  VTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFI
  ECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDF
  RTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFG
  LLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKR
  VRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLE
  RIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYF
  VSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSL
  TFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETD
  DFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

• Structural information:
  • Protein Domains: (92..12-)
    (/note="LisH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00126"-)
  • Interpro: IPR020472  IPR006594  IPR037783  IPR007582  IPR037264   IPR015943  IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS50896 PS00678 PS50082 PS50294
  • CDD: cd08044
  • PDB: 2NXP 6F3T 6MZC 6MZD 6MZL 6MZM
  • PDBsum: 2NXP 6F3T 6MZC 6MZD 6MZL 6MZM
  • DIP: 28150
  • STRING: ENSP00000358854
• Other Databases: GeneCards:  TAF5  Malacards:  TAF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:1990841	promoter-specific chromatin binding	IBA	molecular function
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0043966	histone H3 acetylation	IBA	biological process
GO:0016251	RNA polymerase II general transcription initiation factor activity	IBA	contributes to
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	contributes to
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0006352	DNA-templated transcription, initiation	IDA	biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016251	RNA polymerase II general transcription initiation factor activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)