• Gene id: 6873

Gene Summary

• Gene Symbol: TAF2   Gene   UCSC   Ensembl
• Aliases: CIF150, MRT40, TAF2B, TAFII150
• Gene name: TATA-box binding protein associated factor 2
• Alternate names: transcription initiation factor TFIID subunit 2, 150 kDa cofactor of initiator function, RNA polymerase II TBP-associated factor subunit B, TAF(II)150, TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa, TATA box binding protein (,
• Gene location: 8q24.12 (119832857: 119730772)     Exons: 30     NC_000008.11
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 604912

Protein Summary

• Protein general information: Q6P1X5  
  • Name: Transcription initiation factor TFIID subunit 2 (150 kDa cofactor of initiator function) (RNA polymerase II TBP associated factor subunit B) (TBP associated factor 150 kDa) (Transcription initiation factor TFIID 150 kDa subunit) (TAF(II)150) (TAFII 150) (
  • Length: 1199  
  • Mass: 136971
  • Tissue specificity: Expressed in all tissues tested. {ECO
• Sequence:

  MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRV
  RINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINF
  SLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVY
  THDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYP
  YSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISG
  YIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQ
  CKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQ
  SGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNK
  KKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQQESILALEKFPTP
  ASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMSFQSYFLQ
  KTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPD
  VRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKV
  DRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSGTSHDWRLRCGAVDLY
  FTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSSQDEEEIDMDT
  VHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLEMSMHP
  AASAPLSVFTKESTASKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD

• Structural information:
  • Interpro: IPR042097  IPR016024  IPR037813  
  • PDB: 5FUR 6MZC 6MZL 6MZM
  • PDBsum: 5FUR 6MZC 6MZL 6MZM
  • DIP: 38921
  • STRING: ENSP00000367406
• Other Databases: GeneCards:  TAF2  Malacards:  TAF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IC	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	IBA	biological process
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0005669	transcription factor TFIID complex	IDA	NOT|cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006367	transcription initiation from RNA polymerase II promoter	IMP	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0000086	G2/M transition of mitotic cell cycle	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Autosomal recessive mental retardation	KEGG:H00768
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)