• Gene id: 6870

Gene Summary

• Gene Symbol: TACR3   Gene   UCSC   Ensembl
• Aliases: HH11, NK-3R, NK3, NK3R, NKR, TAC3R, TAC3RL
• Gene name: tachykinin receptor 3
• Alternate names: neuromedin-K receptor, NK-3 receptor, neurokinin B receptor, neurokinin beta receptor,
• Gene location: 4q24 (103719815: 103589467)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins an
• OMIM: 162332

Protein Summary

• Protein general information: P29371  
  • Name: Neuromedin K receptor (NKR) (NK 3 receptor) (NK 3R) (Neurokinin B receptor) (Tachykinin receptor 3)
  • Length: 465  
  • Mass: 52,202
• Sequence:

  MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLT
  NQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIYALHSE
  WYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTK
  VMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
  MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRWCP
  FIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADTTRSSRKKRATPRDPSFNGCSRRNSKSASAT
  SSFISSPYTSVDEYS

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR001681  IPR001013  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000303325
• Other Databases: GeneCards:  TACR3  Malacards:  TACR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004995	tachykinin receptor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007217	tachykinin receptor signaling pathway	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0010460	positive regulation of heart rate	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032590	dendrite membrane	IEA	cellular component
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0042053	regulation of dopamine metabolic process	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042538	hyperosmotic salinity response	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0060259	regulation of feeding behavior	IEA	biological process
GO:0070474	positive regulation of uterine smooth muscle contraction	IEA	biological process
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004995	tachykinin receptor activity	IEA	molecular function
GO:0004995	tachykinin receptor activity	IEA	molecular function
GO:0004995	tachykinin receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007217	tachykinin receptor signaling pathway	IEA	biological process
GO:0007217	tachykinin receptor signaling pathway	TAS	biological process
GO:0007568	aging	IEA	biological process
GO:0010460	positive regulation of heart rate	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0032590	dendrite membrane	IEA	cellular component
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0042053	regulation of dopamine metabolic process	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042538	hyperosmotic salinity response	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0060259	regulation of feeding behavior	IEA	biological process
GO:0070474	positive regulation of uterine smooth muscle contraction	IEA	biological process
GO:0004995	tachykinin receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007217	tachykinin receptor signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Schizophrenia	GAD: 18287949
Congenital hypogonadotropic hypogonadism (CHH)	MIK: 22031817
Congenital hypogonadotropic hypogonadism (nCHH)	MIK: 22031817
Non obstructive azoospermia	MIK: 30390321
Male infertility	MIK: 30390321

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22031817	congenital hypogonadotropic hypogonadism (nCHH)	TACR3 variants (1 frameshift and 2 nonsense deleterious mutations and 4 missense variants), (Tyr267Asn)		525 (352 CHH, 173 nCHH patients)	Male infertility	TAC3 TACR3
30390321	Non obstructive azoospermia, Male infertility	c.G992A (p.W331X)		200 infertile men	Male infertility