• Gene id: 6867

Gene Summary

• Gene Symbol: TACC1   Gene   UCSC   Ensembl
• Aliases: Ga55
• Gene name: transforming acidic coiled-coil containing protein 1
• Alternate names: transforming acidic coiled-coil-containing protein 1, gastric cancer antigen Ga55, taxin-1,
• Gene location: 8p11.22 (39084166: 39487137)     Exons: 93     NC_000001.11
• Gene summary(Entrez): This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by
• OMIM: 605301

Protein Summary

• Protein general information: O75410  
  • Name: Transforming acidic coiled coil containing protein 1 (Gastric cancer antigen Ga55) (Taxin 1)
  • Length: 805  
  • Mass: 87794
  • Tissue specificity: Isoform 1, isoform 3 and isoform 5 are ubiquitous. Isoform 2 is strongly expressed in the brain, weakly detectable in lung and colon, and overexpressed in gastric cancer. Isoform 4 is not detected in normal tissues, but strong expressi
• Sequence:

  MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPIRSPFK
  ESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPEHDFSKISIVR
  PFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAEADLKAGNSCPELVPS
  RRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSS
  DTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLTPKIQKDGISKSAGLEQPTDPVARDG
  PLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPDNFDESMDPFKPTTTLTSSDFCSPTGNHVNE
  ILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKG
  EPEEDLEYFECSNVPVSTINHAFSSSEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSE
  SDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKE
  QALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQ
  VRTKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD

• Structural information:
  • Protein Domains: (215..29-)
    (/note="SPAZ-1)
    (359..50-)
    (/note="SPAZ-2")
  • Interpro: IPR039915  IPR007707  
  • STRING: ENSP00000321703
• Other Databases: GeneCards:  TACC1  Malacards:  TACC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021987	cerebral cortex development	IBA	biological process
GO:0008283	cell population proliferation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0042975	peroxisome proliferator activated receptor binding	IDA	molecular function
GO:0035259	glucocorticoid receptor binding	IDA	molecular function
GO:0030331	estrogen receptor binding	IDA	molecular function
GO:0046966	thyroid hormone receptor binding	IDA	molecular function
GO:0042974	retinoic acid receptor binding	IDA	molecular function
GO:0046965	retinoid X receptor binding	IDA	molecular function
GO:0016922	nuclear receptor binding	IDA	molecular function
GO:2000327	positive regulation of nuclear receptor transcription coactivator activity	IMP	biological process
GO:0007052	mitotic spindle organization	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881