• Gene id: 6866

Gene Summary

• Gene Symbol: TAC3   Gene   UCSC   Ensembl
• Aliases: HH10, NKB, NKNB, PRO1155, ZNEUROK1
• Gene name: tachykinin 3
• Alternate names: tachykinin-3, gamma tachykinin 3, neurokinin b, neuromedin K, preprotachykinin B,
• Gene location: 12q13.3 (57016559: 57009996)     Exons: 9     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded preproprotein is proteolytically processed to generate the mature peptide, which is primarily expressed in the central and peripheral nervous systems and functions
• OMIM: 162330

Protein Summary

• Protein general information: Q9UHF0  
  • Name: Tachykinin 3 (ZNEUROK1) [Cleaved into: Neurokinin B (NKB) (Neuromedin K)]
  • Length: 121  
  • Mass: 13,438
• Sequence:

  MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKEST
  SPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE

• Structural information:
  • Interpro: IPR003635  IPR013055  
  • Prosite: PS00267
  • PDB: 1P9F
  • PDBsum: 1P9F
  • STRING: ENSP00000300108
• Other Databases: GeneCards:  TAC3  Malacards:  TAC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0007217	tachykinin receptor signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005102	receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0007217	tachykinin receptor signaling pathway	IEA	biological process
GO:0007217	tachykinin receptor signaling pathway	TAS	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005102	receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0007217	tachykinin receptor signaling pathway	TAS	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Asthma	GAD: 20580442
Multiple sclerosis	GAD: 17175032
Psychological disorders	GAD: 19086053
Oligoasthenoteratospermia	MIK: 24616785
Hypogonadotropic hypogonadism	MIK: 25636053
Asthenoteratozoospermia	MIK: 24616785
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenoteratospermia	MIK: 24616785
Oligoashenoteratospermia	MIK: 24616785
congenital hypogonadotropic hypogonadism (CHH)	MIK: 22031817
Idiopathic hypogonadotropic hypogonadism (IHH)	MIK: 25636053
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24616785	Asthenoteratospermic, Oligoashenoteratospermic			42 (15 samples normospermic as control group, 12 Asthenoteratospermic and 15 oligoasthenoteratospermic)	Male infertility
25636053	Idiopathic hypogonadotropic hypogonadism (IHH)			963 (75 Idiopathic hypogonadotropic hypogonadism (IHH), 888 controls)	Male infertility, Female infertility	IL17RD TAC3
22031817	congenital hypogonadotropic hypogonadism (nCHH)	TACR3 variants (1 frameshift and 2 nonsense deleterious mutations and 4 missense variants), (Tyr267Asn)		525 (352 CHH, 173 nCHH patients)	Male infertility	TAC3 TACR3
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray