• Gene id: 6865

Gene Summary

• Gene Symbol: TACR2   Gene   UCSC   Ensembl
• Aliases: NK2R, NKNAR, SKR, TAC2R
• Gene name: tachykinin receptor 2
• Alternate names: substance-K receptor, NK-2 receptor, NK-2R, neurokinin 2 receptor, neurokinin A receptor, seven transmembrane helix receptor,
• Gene location: 10q22.1 (69416917: 69403902)     Exons: 5     NC_000010.11
• Gene summary(Entrez): This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins an
• OMIM: 162321

Protein Summary

• Protein general information: P21452  
  • Name: Substance K receptor (SKR) (NK 2 receptor) (NK 2R) (Neurokinin A receptor) (Tachykinin receptor 2)
  • Length: 398  
  • Mass: 44442
• Sequence:

  MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNL
  ALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKA
  VIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLW
  RRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
  MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGR
  PQDGSGLWFGYGLLAPTKTHVEI

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR001681  IPR000913  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000362403
• Other Databases: GeneCards:  TACR2  Malacards:  TACR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097225	sperm midpiece	IBA	cellular component
GO:0004995	tachykinin receptor activity	IBA	molecular function
GO:1902093	positive regulation of flagellated sperm motility	IBA	biological process
GO:0016497	substance K receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004995	tachykinin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004995	tachykinin receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0007217	tachykinin receptor signaling pathway	TAS	biological process
GO:0007588	excretion	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070472	regulation of uterine smooth muscle contraction	IEA	biological process
GO:0014057	positive regulation of acetylcholine secretion, neurotransmission	IEA	biological process
GO:0014827	intestine smooth muscle contraction	IEA	biological process
GO:0033685	negative regulation of luteinizing hormone secretion	IEA	biological process
GO:0035106	operant conditioning	IEA	biological process
GO:0043117	positive regulation of vascular permeability	IEA	biological process
GO:0043270	positive regulation of ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016497	substance K receptor activity	IEA	molecular function
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0070459	prolactin secretion	IEA	biological process
GO:0070474	positive regulation of uterine smooth muscle contraction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0097225	sperm midpiece	IDA	cellular component
GO:0061827	sperm head	IDA	cellular component
GO:0036126	sperm flagellum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902093	positive regulation of flagellated sperm motility	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway

Diseases

Associated diseases	References
Asthma	PMID:19880429
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)