• Gene id: 6863

Gene Summary

• Gene Symbol: TAC1   Gene   UCSC   Ensembl
• Aliases: Hs.2563, NK2, NKNA, NPK, TAC2
• Gene name: tachykinin precursor 1
• Alternate names: protachykinin-1, PPT, neurokinin 1, neurokinin 2, neurokinin A, neurokinin alpha, neuromedin L, neuropeptide K, neuropeptide gamma, preprotachykinin, protachykinin, substance K, substance P, tachykinin 2, tachykinin, precursor 1 (substance K, substance P,,
• Gene location: 7q21.3 (97731958: 97740471)     Exons: 7     NC_000007.14
• Gene summary(Entrez): This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with
• OMIM: 162320

Protein Summary

• Protein general information: P20366  
  • Name: Protachykinin 1 (PPT) [Cleaved into: Substance P; Neurokinin A (NKA) (Neuromedin L) (Substance K); Neuropeptide K (NPK); Neuropeptide gamma; C terminal flanking peptide]
  • Length: 129  
  • Mass: 15,003
• Sequence:

  MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADS
  SIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR

• Structural information:
  • Interpro: IPR013055  IPR008215  IPR008216  
  • Prosite: PS00267
  • PDB: 2B19 2KS9 2KSA 2KSB 4HOM
  • PDBsum: 2B19 2KS9 2KSA 2KSB 4HOM
  • STRING: ENSP00000321106
• Other Databases: GeneCards:  TAC1  Malacards:  TAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001878	response to yeast	IDA	biological process
GO:0002675	positive regulation of acute inflammatory response	IEA	biological process
GO:0005102	receptor binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0007217	tachykinin receptor signaling pathway	IBA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0007320	insemination	TAS	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0009582	detection of abiotic stimulus	TAS	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0010459	negative regulation of heart rate	IEA	biological process
GO:0010634	positive regulation of epithelial cell migration	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0030424	axon	IEA	cellular component
GO:0031835	substance P receptor binding	IEA	molecular function
GO:0032224	positive regulation of synaptic transmission, cholinergic	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0035815	positive regulation of renal sodium excretion	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0045760	positive regulation of action potential	IEA	biological process
GO:0045778	positive regulation of ossification	IEA	biological process
GO:0046878	positive regulation of saliva secretion	IEA	biological process
GO:0048265	response to pain	IEA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:2000854	positive regulation of corticosterone secretion	IEA	biological process
GO:0001878	response to yeast	IDA	biological process
GO:0002675	positive regulation of acute inflammatory response	IEA	biological process
GO:0005102	receptor binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0007217	tachykinin receptor signaling pathway	IEA	biological process
GO:0007217	tachykinin receptor signaling pathway	IBA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0007320	insemination	TAS	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0009582	detection of abiotic stimulus	TAS	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0010459	negative regulation of heart rate	IEA	biological process
GO:0010634	positive regulation of epithelial cell migration	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0030424	axon	IEA	cellular component
GO:0031835	substance P receptor binding	IEA	molecular function
GO:0032224	positive regulation of synaptic transmission, cholinergic	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0035815	positive regulation of renal sodium excretion	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0045760	positive regulation of action potential	IEA	biological process
GO:0045778	positive regulation of ossification	IEA	biological process
GO:0046878	positive regulation of saliva secretion	IEA	biological process
GO:0048265	response to pain	IEA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:2000854	positive regulation of corticosterone secretion	IEA	biological process
GO:0001878	response to yeast	IDA	biological process
GO:0005102	receptor binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0007217	tachykinin receptor signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007320	insemination	TAS	biological process
GO:0009582	detection of abiotic stimulus	TAS	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Human spermatogenesis, oligozoospermia	MIK: 3886437
Male infertility with varicocele	MIK: 3096787
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
3096787	Male infertility with varicocele			121 (55 normal fertile men, 42 fertile men with varicoceles, 24 infertile men with varicoceles)	Male infertility	LH-RH
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)