• Gene id: 6857

Gene Summary

• Gene Symbol: SYT1   Gene   UCSC   Ensembl
• Aliases: BAGOS, P65, SVP65, SYT
• Gene name: synaptotagmin 1
• Alternate names: synaptotagmin-1, synaptotagmin I, sytI,
• Gene location: 12q21.2 (120438112: 120440729)     Exons: 3     NC_000012.12
• Gene summary(Entrez): The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the
• OMIM: 185605

Protein Summary

• Protein general information: P21579  
  • Name: Synaptotagmin 1 (Synaptotagmin I) (SytI) (p65)
  • Length: 422  
  • Mass: 47573
  • Tissue specificity: Expressed in melanocytes (PubMed
• Sequence:

  MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTC
  CFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSL
  DYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTL
  VMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL
  KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG
  KVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

• Structural information:
  • Protein Domains: (142..26-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (273..40-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR001565  IPR015428  
  • Prosite: PS50004
  • PDB: 2K45 2K4A 2K8M 2KI6 2LHA 2N1T 2R83 3F00 3F01 3F04 3F05 4ISQ 4V11 6G5F 6G5K
  • PDBsum: 2K45 2K4A 2K8M 2KI6 2LHA 2N1T 2R83 3F00 3F01 3F04 3F05 4ISQ 4V11 6G5F 6G5K
  • DIP: 34042
  • STRING: ENSP00000261205
• Other Databases: GeneCards:  SYT1  Malacards:  SYT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005544	calcium-dependent phospholipid binding	ISS	molecular function
GO:0005544	calcium-dependent phospholipid binding	TAS	molecular function
GO:0017075	syntaxin-1 binding	ISS	molecular function
GO:1903305	regulation of regulated secretory pathway	ISS	biological process
GO:0000149	SNARE binding	ISS	molecular function
GO:0043005	neuron projection	ISS	cellular component
GO:0050806	positive regulation of synaptic transmission	ISS	biological process
GO:0071277	cellular response to calcium ion	ISS	biological process
GO:0098746	fast, calcium ion-dependent exocytosis of neurotransmitter	ISS	biological process
GO:0098746	fast, calcium ion-dependent exocytosis of neurotransmitter	ISS	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IBA	biological process
GO:0031045	dense core granule	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0017158	regulation of calcium ion-dependent exocytosis	IBA	biological process
GO:0017156	calcium-ion regulated exocytosis	IBA	biological process
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0016079	synaptic vesicle exocytosis	IBA	biological process
GO:0014059	regulation of dopamine secretion	IBA	biological process
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0048488	synaptic vesicle endocytosis	IBA	biological process
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0030276	clathrin binding	IBA	molecular function
GO:0019905	syntaxin binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0000149	SNARE binding	IBA	molecular function
GO:1903235	positive regulation of calcium ion-dependent exocytosis of neurotransmitter	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0050750	low-density lipoprotein particle receptor binding	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0060201	clathrin-sculpted acetylcholine transport vesicle membrane	TAS	cellular component
GO:0060201	clathrin-sculpted acetylcholine transport vesicle membrane	TAS	cellular component
GO:0060201	clathrin-sculpted acetylcholine transport vesicle membrane	TAS	cellular component
GO:0060203	clathrin-sculpted glutamate transport vesicle membrane	TAS	cellular component
GO:0060203	clathrin-sculpted glutamate transport vesicle membrane	TAS	cellular component
GO:0060203	clathrin-sculpted glutamate transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0014047	glutamate secretion	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0061202	clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS	cellular component
GO:0061202	clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005513	detection of calcium ion	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0017075	syntaxin-1 binding	IEA	molecular function
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0031045	dense core granule	IEA	cellular component
GO:0033603	positive regulation of dopamine secretion	IEA	biological process
GO:0043229	intracellular organelle	IEA	cellular component
GO:0045956	positive regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0048278	vesicle docking	IEA	biological process
GO:0051291	protein heterooligomerization	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:1903305	regulation of regulated secretory pathway	IEA	biological process
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0014059	regulation of dopamine secretion	IEA	biological process
GO:0016079	synaptic vesicle exocytosis	IEA	biological process
GO:0017075	syntaxin-1 binding	IEA	molecular function
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0031045	dense core granule	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0061669	spontaneous neurotransmitter secretion	IEA	biological process
GO:0061891	calcium ion sensor activity	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099502	calcium-dependent activation of synaptic vesicle fusion	IEA	biological process
GO:1903235	positive regulation of calcium ion-dependent exocytosis of neurotransmitter	IEA	biological process
GO:0000149	SNARE binding	IEA	molecular function
GO:0005543	phospholipid binding	IEA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0019905	syntaxin binding	IEA	molecular function
GO:0030276	clathrin binding	IEA	molecular function
GO:0030348	syntaxin-3 binding	IEA	molecular function
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0031340	positive regulation of vesicle fusion	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0044306	neuron projection terminus	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048306	calcium-dependent protein binding	IEA	molecular function
GO:0060076	excitatory synapse	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0048306	calcium-dependent protein binding	IEA	molecular function
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0071911	synchronous neurotransmitter secretion	IEA	biological process
GO:0098746	fast, calcium ion-dependent exocytosis of neurotransmitter	IEA	biological process
GO:0042584	chromaffin granule membrane	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:1903861	positive regulation of dendrite extension	IDA	biological process
GO:0008021	synaptic vesicle	TAS	cellular component
GO:0017157	regulation of exocytosis	TAS	biological process
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0005513	detection of calcium ion	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04721	Synaptic vesicle cycle

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)