• Gene id: 6854

Gene Summary

• Gene Symbol: SYN2   Gene   UCSC   Ensembl
• Aliases: SYNII
• Gene name: synapsin II
• Alternate names: synapsin-2,
• Gene location: 3p25.2 (12004359: 12192031)     Exons: 17     NC_000003.12
• Gene summary(Entrez): This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptog
• OMIM: 600849

Protein Summary

• Protein general information: Q92777  
  • Name: Synapsin 2 (Synapsin II)
  • Length: 582  
  • Mass: 62996
  • Tissue specificity: Central and peripheral nervous systems.
• Sequence:

  MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQPPPPPPPGPGAASASAAPPTASPGPERRPPPASAPAPQPAPT
  PSVGSSFFSSLSQAVKQTAASAGLVDAPAPAPAAARKAKVLLVVDEPHADWAKCFRGKKVLGDYDIKVEQAEFSE
  LNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLIIGMQYAGLPSINSLESIYNFCDK
  PWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQT
  YATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEMFGGLDICAVKAV
  HGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSRTPALSPQRPLTTQQPQSGTLKDPDSSKTPP
  QRPPPQGGPGQPQGMQPPGKVLPPRRLPPGPSLPPSSSSSSSSSSSAPQRPGGPTTHGDAPSSSSSLAEAQPPLA
  APPQKPQPHPQLNKSQSLTNAFSFSESSFFRSSANEDEAKAETIRSLRKSFASLFSD

• Structural information:
  • Interpro: IPR013815  IPR016185  IPR028712  IPR001359  IPR020898   IPR019735  IPR019736  IPR020897  
  • Prosite: PS00415 PS00416
  • STRING: ENSP00000480050
• Other Databases: GeneCards:  SYN2  Malacards:  SYN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007269	neurotransmitter secretion	ISS	biological process
GO:0005524	ATP binding	TAS	molecular function
GO:0030672	synaptic vesicle membrane	ISS	cellular component
GO:0045202	synapse	ISS	cellular component
GO:0007269	neurotransmitter secretion	IBA	biological process
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0099504	synaptic vesicle cycle	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0017156	calcium-ion regulated exocytosis	IEA	biological process
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0097091	synaptic vesicle clustering	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007269	neurotransmitter secretion	ISS	biological process
GO:0005524	ATP binding	TAS	molecular function
GO:0030672	synaptic vesicle membrane	ISS	cellular component
GO:0045202	synapse	ISS	cellular component
GO:0007269	neurotransmitter secretion	IBA	biological process
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0099504	synaptic vesicle cycle	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0017156	calcium-ion regulated exocytosis	IEA	biological process
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0097091	synaptic vesicle clustering	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

Diseases

Associated diseases	References
Schizophrenia	KEGG:H01649
Schizophrenia	KEGG:H01649
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881