• Gene id: 6850

Gene Summary

• Gene Symbol: SYK   Gene   UCSC   Ensembl
• Aliases: p72-Syk
• Gene name: spleen associated tyrosine kinase
• Alternate names: tyrosine-protein kinase SYK, spleen tyrosine kinase,
• Gene location: 9q22.2 (90801599: 90898548)     Exons: 16     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular r
• OMIM: 600085

Protein Summary

• Protein general information: P43405  
  • Name: Tyrosine protein kinase SYK (EC 2.7.10.2) (Spleen tyrosine kinase) (p72 Syk)
  • Length: 635  
  • Mass: 72066
  • Tissue specificity: Widely expressed in hematopoietic cells (at protein level) (PubMed
• Sequence:

  MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYA
  IAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQ
  KPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGK
  LSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
  PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDK
  ELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEM
  AELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENY
  YKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
  MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN

• Structural information:
  • Protein Domains: (15..10-)
    (/note="SH2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (168..25-)
    (/note="SH2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (371..63-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU001-)
  • Interpro: IPR011009  IPR023420  IPR000719  IPR017441  IPR001245   IPR000980  IPR036860  IPR035838  IPR008266  IPR020635  IPR012234  
  • Prosite: PS00107 PS50011 PS00109 PS50001
  • CDD: cd09938
  • PDB: 1A81 1CSY 1CSZ 1XBA 1XBB 1XBC 3BUW 3EMG 3FQE 3FQH 3FQS 3SRV 3TUB 3TUC 3TUD 3VF8 3VF9 4DFL 4DFN 4F4P 4FL1 4FL2 4FL3 4FYN 4FYO 4FZ6 4FZ7 4GFG 4I0R 4I0S 4I0T 4PUZ 4PV0 4PX6 4RSS 4RX7 4RX8 4RX9 4WNM 4XG2 4XG3 4XG4 4XG6 4XG7 4XG8 4XG9 4YJO 4YJP 4YJQ 4YJR 4YJS 4YJT 4YJU 4YJV 5C26 5C27 5CXH 5CXZ 5CY3 5GHV 5LMA 5LMB 5T68 5TI
  • PDBsum: 1A81 1CSY 1CSZ 1XBA 1XBB 1XBC 3BUW 3EMG 3FQE 3FQH 3FQS 3SRV 3TUB 3TUC 3TUD 3VF8 3VF9 4DFL 4DFN 4F4P 4FL1 4FL2 4FL3 4FYN 4FYO 4FZ6 4FZ7 4GFG 4I0R 4I0S 4I0T 4PUZ 4PV0 4PX6 4RSS 4RX7 4RX8 4RX9 4WNM 4XG2 4XG3 4XG4 4XG6 4XG7 4XG8 4XG9 4YJO 4YJP 4YJQ 4YJR 4YJS 4YJT 4YJU 4YJV 5C26 5C27 5CXH 5CXZ 5CY3 5GHV 5LMA 5LMB 5T68 5TI
  • DIP: 253
  • STRING: ENSP00000364907
• Other Databases: GeneCards:  SYK  Malacards:  SYK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004713	protein tyrosine kinase activity	NAS	molecular function
GO:0045084	positive regulation of interleukin-12 biosynthetic process	IMP	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IMP	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0045082	positive regulation of interleukin-10 biosynthetic process	IMP	biological process
GO:0045410	positive regulation of interleukin-6 biosynthetic process	IMP	biological process
GO:0042535	positive regulation of tumor necrosis factor biosynthetic process	IMP	biological process
GO:0051712	positive regulation of killing of cells of other organism	IMP	biological process
GO:0031334	positive regulation of protein-containing complex assembly	IMP	biological process
GO:0032930	positive regulation of superoxide anion generation	IMP	biological process
GO:0071639	positive regulation of monocyte chemotactic protein-1 production	IMP	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0045579	positive regulation of B cell differentiation	IMP	biological process
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0002250	adaptive immune response	IBA	biological process
GO:0002281	macrophage activation involved in immune response	IBA	biological process
GO:0002283	neutrophil activation involved in immune response	IBA	biological process
GO:0045579	positive regulation of B cell differentiation	IBA	biological process
GO:0090330	regulation of platelet aggregation	IBA	biological process
GO:0033630	positive regulation of cell adhesion mediated by integrin	IBA	biological process
GO:0043306	positive regulation of mast cell degranulation	IBA	biological process
GO:0046641	positive regulation of alpha-beta T cell proliferation	IBA	biological process
GO:0050853	B cell receptor signaling pathway	IBA	biological process
GO:0005829	cytosol	IC	cellular component
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0050853	B cell receptor signaling pathway	ISS	biological process
GO:0048514	blood vessel morphogenesis	ISS	biological process
GO:0045780	positive regulation of bone resorption	ISS	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0043313	regulation of neutrophil degranulation	ISS	biological process
GO:0033630	positive regulation of cell adhesion mediated by integrin	ISS	biological process
GO:0032928	regulation of superoxide anion generation	ISS	biological process
GO:0032009	early phagosome	ISS	cellular component
GO:0010543	regulation of platelet activation	ISS	biological process
GO:0007229	integrin-mediated signaling pathway	ISS	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0002366	leukocyte activation involved in immune response	ISS	biological process
GO:0071404	cellular response to low-density lipoprotein particle stimulus	ISS	biological process
GO:0032753	positive regulation of interleukin-4 production	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0090330	regulation of platelet aggregation	ISS	biological process
GO:0090237	regulation of arachidonic acid secretion	ISS	biological process
GO:0071226	cellular response to molecule of fungal origin	ISS	biological process
GO:0050764	regulation of phagocytosis	ISS	biological process
GO:0042742	defense response to bacterium	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002554	serotonin secretion by platelet	ISS	biological process
GO:0002283	neutrophil activation involved in immune response	ISS	biological process
GO:0002281	macrophage activation involved in immune response	ISS	biological process
GO:0002250	adaptive immune response	ISS	biological process
GO:0001945	lymph vessel development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031623	receptor internalization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0038156	interleukin-3-mediated signaling pathway	ISS	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0002250	adaptive immune response	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0042101	T cell receptor complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0051090	regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0006606	protein import into nucleus	IMP	biological process
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0038110	interleukin-2-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071404	cellular response to low-density lipoprotein particle stimulus	IEA	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050715	positive regulation of cytokine secretion	IEA	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0046641	positive regulation of alpha-beta T cell proliferation	IEA	biological process
GO:0046638	positive regulation of alpha-beta T cell differentiation	IEA	biological process
GO:0045780	positive regulation of bone resorption	IEA	biological process
GO:0045425	positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process	IEA	biological process
GO:0045401	positive regulation of interleukin-3 biosynthetic process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0043366	beta selection	IEA	biological process
GO:0043313	regulation of neutrophil degranulation	IEA	biological process
GO:0043306	positive regulation of mast cell degranulation	IEA	biological process
GO:0038063	collagen-activated tyrosine kinase receptor signaling pathway	IEA	biological process
GO:0033630	positive regulation of cell adhesion mediated by integrin	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032928	regulation of superoxide anion generation	IEA	biological process
GO:0032753	positive regulation of interleukin-4 production	IEA	biological process
GO:0032009	early phagosome	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0010543	regulation of platelet activation	IEA	biological process
GO:0007257	activation of JUN kinase activity	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0002366	leukocyte activation involved in immune response	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0090330	regulation of platelet aggregation	IEA	biological process
GO:0090237	regulation of arachidonic acid secretion	IEA	biological process
GO:0071226	cellular response to molecule of fungal origin	IEA	biological process
GO:0050764	regulation of phagocytosis	IEA	biological process
GO:0045588	positive regulation of gamma-delta T cell differentiation	IEA	biological process
GO:0045579	positive regulation of B cell differentiation	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042169	SH2 domain binding	IEA	molecular function
GO:0038156	interleukin-3-mediated signaling pathway	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0035325	Toll-like receptor binding	IEA	molecular function
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0031623	receptor internalization	IEA	biological process
GO:0019902	phosphatase binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019815	B cell receptor complex	IEA	cellular component
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0007167	enzyme linked receptor protein signaling pathway	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0002554	serotonin secretion by platelet	IEA	biological process
GO:0002283	neutrophil activation involved in immune response	IEA	biological process
GO:0002281	macrophage activation involved in immune response	IEA	biological process
GO:0002092	positive regulation of receptor internalization	IEA	biological process
GO:0001945	lymph vessel development	IEA	biological process
GO:0001820	serotonin secretion	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0001784	phosphotyrosine residue binding	IMP	molecular function
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0004672	protein kinase activity	NAS	molecular function
GO:0016170	interleukin-15 receptor binding	IPI	molecular function
GO:0007229	integrin-mediated signaling pathway	NAS	biological process
GO:0005178	integrin binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04151	PI3K-Akt signaling pathway
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04072	Phospholipase D signaling pathway
hsa05152	Tuberculosis
hsa04380	Osteoclast differentiation
hsa04611	Platelet activation
hsa04650	Natural killer cell mediated cytotoxicity
hsa04064	NF-kappa B signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04666	Fc gamma R-mediated phagocytosis
hsa04662	B cell receptor signaling pathway
hsa04664	Fc epsilon RI signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881