• Gene id: 6847

Gene Summary

• Gene Symbol: SYCP1   Gene   UCSC   Ensembl
• Aliases: CT8, HOM-TES-14, SCP-1, SCP1
• Gene name: synaptonemal complex protein 1
• Alternate names: synaptonemal complex protein 1, cancer/testis antigen 8, testicular tissue protein Li 191,
• Gene location: 1p13.2 (114854267: 114995369)     Exons: 38     NC_000001.11
• OMIM: 602162

Protein Summary

• Protein general information: Q15431  
  • Name: Synaptonemal complex protein 1 (SCP 1) (Cancer/testis antigen 8) (CT8)
  • Length: 976  
  • Mass: 114,192
• Sequence:

  MEKQKPFALFVPPRSSSSQVSAVKPQTLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLP
  VLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQE
  LQFGNEKVSLKLEEGIQENKDLIKENNATRHLCNLLKETCARSAEKTKKYEYEREETRQVYMDLNNNIEKMITAF
  EELRVQAENSRLEMHFKLKEDYEKIQHLEQEYKKEINDKEKQVSLLLIQITEKENKMKDLTFLLEESRDKVNQLE
  EKTKLQSENLKQSIEKQHHLTKELEDIKVSLQRSVSTQKALEEDLQIATKTICQLTEEKETQMEESNKARAAHSF
  VVTEFETTVCSLEELLRTEQQRLEKNEDQLKILTMELQKKSSELEEMTKLTNNKEVELEELKKVLGEKETLLYEN
  KQFEKIAEELKGTEQELIGLLQAREKEVHDLEIQLTAITTSEQYYSKEVKDLKTELENEKLKNTELTSHCNKLSL
  ENKELTQETSDMTLELKNQQEDINNNKKQEERMLKQIENLQETETQLRNELEYVREELKQKRDEVKCKLDKSEEN
  CNNLRKQVENKNKYIEELQQENKALKKKGTAESKQLNVYEIKVNKLELELESAKQKFGEITDTYQKEIEDKKISE
  ENLLEEVEKAKVIADEAVKLQKEIDKRCQHKIAEMVALMEKHKHQYDKIIEERDSELGLYKSKEQEQSSLRASLE
  IELSNLKAELLSVKKQLEIEREEKEKLKREAKENTATLKEKKDKKTQTFLLETPEIYWKLDSKAVPSQTVSRNFT
  SVDHGISKDKRDYLWTSAKNTLSTPLPKAYTVKTPTKPKLQQRENLNIPIEESKKKRKMAFEFDINSDSSETTDL
  LSMVSEEETLKTLYRNNNPPASHLCVKTPKKAPSSLTTPGSTLKFGAIRKMREDRWAVIAKMDRKKKLKEAEKLF
  V

• Structural information:
  • Interpro: IPR008827  IPR024835  
  • PDB: 4YTO
  • PDBsum: 4YTO
  • STRING: ENSP00000358531
• Other Databases: GeneCards:  SYCP1  Malacards:  SYCP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000711	meiotic DNA repair synthesis	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000795	synaptonemal complex	ISS	cellular component
GO:0000801	central element	IEA	cellular component
GO:0000802	transverse filament	IEA	cellular component
GO:0001673	male germ cell nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007129	synapsis	ISS	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007131	reciprocal meiotic recombination	ISS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0032880	regulation of protein localization	IEA	biological process
GO:0035092	sperm chromatin condensation	IEA	biological process
GO:0051026	chiasma assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051878	lateral element assembly	IEA	biological process
GO:0000711	meiotic DNA repair synthesis	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000794	condensed nuclear chromosome	IEA	cellular component
GO:0000795	synaptonemal complex	IEA	cellular component
GO:0000795	synaptonemal complex	IEA	cellular component
GO:0000795	synaptonemal complex	ISS	cellular component
GO:0000801	central element	IEA	cellular component
GO:0000802	transverse filament	IEA	cellular component
GO:0001673	male germ cell nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0007129	synapsis	ISS	biological process
GO:0007130	synaptonemal complex assembly	IEA	biological process
GO:0007130	synaptonemal complex assembly	IEA	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007131	reciprocal meiotic recombination	ISS	biological process
GO:0007131	reciprocal meiotic recombination	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0032880	regulation of protein localization	IEA	biological process
GO:0035092	sperm chromatin condensation	IEA	biological process
GO:0051026	chiasma assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0051878	lateral element assembly	IEA	biological process
GO:0000795	synaptonemal complex	ISS	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0007129	synapsis	ISS	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007131	reciprocal meiotic recombination	ISS	biological process
GO:0007131	reciprocal meiotic recombination	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process

Diseases

Associated diseases	References
Sertoli cell only syndrome (SCOS)	MIK: 18706547
Azoospermia	MIK: 20378615
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 9436675
Spermatogenic defects	MIK: 26869299
Sertoli cell-only syndrome (SCOS)	MIK: 18706547
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18706547	Sertoli cell-only syndrome (SCOS), male infertility			24 (20 healthy males of proven fertility underwent a vasectomy, 4 infertile patiets)	Male infertility	SYCP1
9436675	Contributes to male infertility				Male infertility
26869299	Important for spermatogonial differentiation, Male infertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray