• Gene id: 6845

Gene Summary

• Gene Symbol: VAMP7   Gene   UCSC   Ensembl
• Aliases: SYBL1, TI-VAMP, TIVAMP, VAMP-7
• Gene name: vesicle associated membrane protein 7
• Alternate names: vesicle-associated membrane protein 7, synaptobrevin-like 1, synaptobrevin-like protein 1, tetanus neurotoxin-insensitive VAMP, tetanus-insensitive VAMP,
• Gene location: Xq28 and Yq12 (155881317: 155943768)     Exons: 8     NC_000023.11
• Gene summary(Entrez): This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transpor
• OMIM: 300053

Protein Summary

• Protein general information: P51809  
  • Name: Vesicle associated membrane protein 7 (VAMP 7) (Synaptobrevin like protein 1) (Tetanus insensitive VAMP) (Ti VAMP)
  • Length: 220  
  • Mass: 24935
  • Tissue specificity: Detected in all tissues tested.
• Sequence:

  MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRA
  FNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQR
  GERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK

• Structural information:
  • Protein Domains: (7..11-)
    (/note="Longin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00231-)
    (125..18-)
    homology (/note="v-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00290"-)
  • Interpro: IPR011012  IPR010908  IPR001388  IPR042855  
  • Prosite: PS50859 PS00417 PS50892
  • PDB: 2DMW
  • PDBsum: 2DMW
  • STRING: ENSP00000262640
• Other Databases: GeneCards:  VAMP7  Malacards:  VAMP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006906	vesicle fusion	IBA	biological process
GO:0008333	endosome to lysosome transport	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0000149	SNARE binding	IBA	molecular function
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0006887	exocytosis	IBA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0097352	autophagosome maturation	IMP	NOT|biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0031201	SNARE complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006892	post-Golgi vesicle-mediated transport	TAS	biological process
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900483	regulation of protein targeting to vacuolar membrane	IEA	biological process
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045177	apical part of cell	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048280	vesicle fusion with Golgi apparatus	IEA	biological process
GO:0047496	vesicle transport along microtubule	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0034197	triglyceride transport	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0017156	calcium-ion regulated exocytosis	IEA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0008333	endosome to lysosome transport	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0006906	vesicle fusion	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0043001	Golgi to plasma membrane protein transport	IEA	biological process
GO:0035493	SNARE complex assembly	IEA	biological process
GO:0031143	pseudopodium	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0043312	neutrophil degranulation	IEA	biological process
GO:0043308	eosinophil degranulation	IEA	biological process
GO:0019905	syntaxin binding	IEA	molecular function
GO:0006911	phagocytosis, engulfment	IEA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0031201	SNARE complex	IDA	cellular component
GO:0030141	secretory granule	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0035577	azurophil granule membrane	IDA	cellular component
GO:0030667	secretory granule membrane	IDA	cellular component
GO:0031091	platelet alpha granule	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0031143	pseudopodium	IDA	cellular component
GO:0016192	vesicle-mediated transport	IDA	biological process
GO:0008333	endosome to lysosome transport	IDA	biological process
GO:0006906	vesicle fusion	IDA	biological process
GO:0043308	eosinophil degranulation	IMP	biological process
GO:0043312	neutrophil degranulation	IMP	biological process
GO:0043320	natural killer cell degranulation	IMP	biological process
GO:1903595	positive regulation of histamine secretion by mast cell	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043308	eosinophil degranulation	ISS	biological process
GO:0006911	phagocytosis, engulfment	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component
GO:0031902	late endosome membrane	ISS	cellular component
GO:0031201	SNARE complex	ISS	cellular component
GO:0017156	calcium-ion regulated exocytosis	ISS	biological process
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0005765	lysosomal membrane	ISS	cellular component
GO:0045335	phagocytic vesicle	ISS	cellular component
GO:0043312	neutrophil degranulation	ISS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)