• Gene id: 6843

Gene Summary

• Gene Symbol: VAMP1   Gene   UCSC   Ensembl
• Aliases: CMS25, SPAX1, SYB1, VAMP-1
• Gene name: vesicle associated membrane protein 1
• Alternate names: vesicle-associated membrane protein 1, vesicle-associated membrane protein 1 (synaptobrevin 1),
• Gene location: 12p13.31 (151805418: 151800263)     Exons: 2     NC_000001.11
• Gene summary(Entrez): Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member
• OMIM: 185880

Protein Summary

• Protein general information: P23763  
  • Name: Vesicle associated membrane protein 1 (VAMP 1) (Synaptobrevin 1)
  • Length: 118  
  • Mass: 12902
  • Tissue specificity: Nervous system, skeletal muscle and adipose tissue.
• Sequence:

  MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAG
  ASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT

• Structural information:
  • Protein Domains: (33..9-)
    homology (/note="v-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00290"-)
  • Interpro: IPR001388  IPR016444  IPR042855  
  • Prosite: PS00417 PS50892
  • STRING: ENSP00000379602
• Other Databases: GeneCards:  VAMP1  Malacards:  VAMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006906	vesicle fusion	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0019905	syntaxin binding	IBA	molecular function
GO:0035493	SNARE complex assembly	IBA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098793	presynapse	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0035493	SNARE complex assembly	IEA	biological process
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0016082	synaptic vesicle priming	IEA	biological process
GO:0031630	regulation of synaptic vesicle fusion to presynaptic active zone membrane	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005829	cytosol	IDA	NOT|cellular component
GO:0035577	azurophil granule membrane	IDA	NOT|cellular component
GO:0035579	specific granule membrane	IDA	cellular component
GO:0070821	tertiary granule membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Congenital myasthenic syndrome	KEGG:H00770
Spastic ataxia	KEGG:H01351
Congenital myasthenic syndrome	KEGG:H00770
Spastic ataxia	KEGG:H01351
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881