• Gene id: 6838

Gene Summary

• Gene Symbol: SURF6   Gene   UCSC   Ensembl
• Aliases: RRP14
• Gene name: surfeit 6
• Alternate names: surfeit locus protein 6,
• Gene location: 9q34.2 (133336187: 133328775)     Exons: 5     NC_000009.12
• Gene summary(Entrez): This gene encodes a conserved protein that is localized to the nucleolus. The encoded protein may function as a nucleolar-matrix protein with nucleic acid-binding properties. There is a pseudogene for this gene on chromosome Y. Alternative splicing result
• OMIM: 185642

Protein Summary

• Protein general information: O75683  
  • Name: Surfeit locus protein 6
  • Length: 361  
  • Mass: 41450
• Sequence:

  MASLLAKDAYLQSLAKKICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKAKSLGEKSP
  AASGARRPEAAKEEAAWASSSAGNPADGLATEPESVFALDVLRQRLHEKIQEARGQGSAKELSPAALEKRRRRKQ
  ERDRKKRKRKELRAKEKARKAEEATEAQEVVEATPEGACTEPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVK
  GNLTPLTGRNYRQLLERLQARQSRLDELRGQDEGKAQELEAKMKWTNLLYKAEGVKIRDDERLLQEALKRKEKRR
  AQRQRRWEKRTAGVVEKMQQRQDRRRQNLRRKKAARAERRLLRARKKGRILPQDLERAGLV

• Structural information:
  • Interpro: IPR029190  IPR007019  
  • STRING: ENSP00000361092
• Other Databases: GeneCards:  SURF6  Malacards:  SURF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042274	ribosomal small subunit biogenesis	IBA	biological process
GO:0042273	ribosomal large subunit biogenesis	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0005730	nucleolus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0001652	granular component	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0001652	granular component	ISS	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	ISS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003677	DNA binding	ISS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq