• Gene id: 6837

Gene Summary

• Gene Symbol: MED22   Gene   UCSC   Ensembl
• Aliases: MED24, SRB6, SURF5, surf-5
• Gene name: mediator complex subunit 22
• Alternate names: mediator of RNA polymerase II transcription subunit 22, surfeit locus protein 5,
• Gene location: 9q34.2 (133348155: 133338311)     Exons: 5     NC_000009.12
• Gene summary(Entrez): This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively splice

Protein Summary

• Protein general information: Q15528  
  • Name: Mediator of RNA polymerase II transcription subunit 22 (Mediator complex subunit 22) (Surfeit locus protein 5) (Surf 5)
  • Length: 200  
  • Mass: 22221
• Sequence:

  MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESL
  MKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSSLCEANDLPLC
  EAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA

• Structural information:
  • Interpro: IPR009332  IPR038427  
  • STRING: ENSP00000482438
• Other Databases: GeneCards:  MED22  Malacards:  MED22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016592	mediator complex	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016592	mediator complex	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0016592	mediator complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray