• Gene id: 6832

Gene Summary

• Gene Symbol: SUPV3L1   Gene   UCSC   Ensembl
• Aliases: SUV3
• Gene name: Suv3 like RNA helicase
• Alternate names: ATP-dependent RNA helicase SUPV3L1, mitochondrial, SUV3-like helicase, SUV3-like protein 1, suppressor of var1, 3-like 1, suppressor of var1, 3-like 1(SUV3),
• Gene location: 10q22.1 (69180233: 69209092)     Exons: 17     NC_000010.11
• OMIM: 605122

Protein Summary

• Protein general information: Q8IYB8  
  • Name: ATP dependent RNA helicase SUPV3L1, mitochondrial (EC 3.6.4.13) (Suppressor of var1 3 like protein 1) (SUV3 like protein 1)
  • Length: 786  
  • Mass: 87991
  • Tissue specificity: Broadly expressed. {ECO
• Sequence:

  MSFSRALLWARLPAGRQAGHRAAICSALRPHFGPFPGVLGQVSVLATASSSASGGSKIPNTSLFVPLTVKPQGPS
  ADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFHQAFISFRNYIMQSHSLDVDIHIVLNDICF
  GAAHADDLFPFFLRHAKQIFPVLDCKDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFSAK
  SGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPA
  RGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALESLDNLRPGDCIVCFSK
  NDIYSVSRQIEIRGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKILVATDAIGMGLNLSIRRIIFYSLIKPSINE
  KGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLP
  DATLSNLIDIFVDFSQVDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRN
  EPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASLIRDLQKELDGIIQDGVHNITK
  LIKMSETHKLLNLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKATEPPSPDAGELSLASRLVQQGLLTPDMLKQ
  LEKEWMTQQTEHNKEKTESGTHPKGTRRKKKEPDSD

• Structural information:
  • Protein Domains: (194..33-)
    (/note="Helicase-ATP-binding)
    (353..51-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542"-)
  • Interpro: IPR001650  IPR027417  IPR022192  IPR041082  IPR041453  
  • Prosite: PS51194
  • PDB: 3RC3 3RC8
  • PDBsum: 3RC3 3RC8
  • STRING: ENSP00000352678
• Other Databases: GeneCards:  SUPV3L1  Malacards:  SUPV3L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006401	RNA catabolic process	IBA	biological process
GO:0000965	mitochondrial RNA 3'-end processing	IBA	biological process
GO:0003724	RNA helicase activity	IBA	molecular function
GO:0045025	mitochondrial degradosome	IBA	cellular component
GO:0034458	3'-5' RNA helicase activity	IDA	molecular function
GO:0000962	positive regulation of mitochondrial RNA catabolic process	IDA	biological process
GO:0045025	mitochondrial degradosome	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003724	RNA helicase activity	IDA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:2000827	mitochondrial RNA surveillance	IMP	biological process
GO:0070827	chromatin maintenance	IMP	biological process
GO:0070584	mitochondrion morphogenesis	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0035946	mitochondrial mRNA surveillance	IMP	biological process
GO:0035945	mitochondrial ncRNA surveillance	IMP	biological process
GO:0006401	RNA catabolic process	IMP	biological process
GO:0000962	positive regulation of mitochondrial RNA catabolic process	IMP	biological process
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0006310	DNA recombination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000965	mitochondrial RNA 3'-end processing	IMP	biological process
GO:0000958	mitochondrial mRNA catabolic process	IMP	biological process
GO:0016817	hydrolase activity, acting on acid anhydrides	IEA	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0004386	helicase activity	TAS	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0045025	mitochondrial degradosome	IDA	cellular component
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0000962	positive regulation of mitochondrial RNA catabolic process	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003677	DNA binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032508	DNA duplex unwinding	IMP	biological process
GO:0003678	DNA helicase activity	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881