• Gene id: 6827

Gene Summary

• Gene Symbol: SUPT4H1   Gene   UCSC   Ensembl
• Aliases: SPT4, SPT4H, SUPT4H, Supt4a
• Gene name: SPT4 homolog, DSIF elongation factor subunit
• Alternate names: transcription elongation factor SPT4, DRB sensitivity-inducing factor 14 kDa subunit, DSIF p14, small hSpt4 subunit, suppressor of Ty 4 homolog 1,
• Gene location: 17q22 (58352200: 58345177)     Exons: 5     NC_000017.11
• Gene summary(Entrez): This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized t
• OMIM: 603555

Protein Summary

• Protein general information: P63272  
  • Name: Transcription elongation factor SPT4 (hSPT4) (DRB sensitivity inducing factor 14 kDa subunit) (DSIF p14) (DRB sensitivity inducing factor small subunit) (DSIF small subunit)
  • Length: 117  
  • Mass: 13193
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQ
  RVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

• Structural information:
  • Interpro: IPR029040  IPR009287  IPR022800  IPR038510  
  • CDD: cd07973
  • PDB: 3H7H 5OIK 6GMH 6GML
  • PDBsum: 3H7H 5OIK 6GMH 6GML
  • DIP: 40644
  • STRING: ENSP00000225504
• Other Databases: GeneCards:  SUPT4H1  Malacards:  SUPT4H1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006325	chromatin organization	IBA	biological process
GO:0032044	DSIF complex	IBA	cellular component
GO:0034243	regulation of transcription elongation from RNA polymerase II promoter	IBA	biological process
GO:0000993	RNA polymerase II complex binding	IBA	molecular function
GO:0003727	single-stranded RNA binding	IBA	molecular function
GO:0006397	mRNA processing	IBA	biological process
GO:0032044	DSIF complex	IDA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0032786	positive regulation of DNA-templated transcription, elongation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0050434	positive regulation of viral transcription	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034244	negative regulation of transcription elongation from RNA polymerase II promoter	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0032785	negative regulation of DNA-templated transcription, elongation	IDA	biological process
GO:0032785	negative regulation of DNA-templated transcription, elongation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	IDA	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0032786	positive regulation of DNA-templated transcription, elongation	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)