• Gene id: 6822

Gene Summary

• Gene Symbol: SULT2A1   Gene   UCSC   Ensembl
• Aliases: DHEA-ST, DHEAS, HST, ST2, ST2A1, ST2A3, STD, hSTa
• Gene name: sulfotransferase family 2A member 1
• Alternate names: bile salt sulfotransferase, alcohol/hydroxysteroid sulfotransferase, bile-salt sulfotranasferase 2A1, sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1,
• Gene location: 19q13.33 (47886396: 47870465)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This pr
• OMIM: 125263

Protein Summary

• Protein general information: Q06520  
  • Name: Bile salt sulfotransferase (EC 2.8.2.14) (Dehydroepiandrosterone sulfotransferase) (DHEA ST) (Hydroxysteroid Sulfotransferase) (HST) (ST2) (ST2A3) (Sulfotransferase 2A1) (ST2A1)
  • Length: 285  
  • Mass: 33,780
• Sequence:

  MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERS
  PWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYF
  EWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKE
  NKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

• Structural information:
  • Interpro: IPR027417  IPR000863  
  • PDB: 1EFH 1J99 1OV4 2QP3 2QP4 3F3Y 4IFB
  • PDBsum: 1EFH 1J99 1OV4 2QP3 2QP4 3F3Y 4IFB
  • STRING: ENSP00000222002
• Other Databases: GeneCards:  SULT2A1  Malacards:  SULT2A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004304	estrone sulfotransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007586	digestion	NAS	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008202	steroid metabolic process	TAS	biological process
GO:0030573	bile acid catabolic process	IEA	biological process
GO:0047704	bile-salt sulfotransferase activity	IEA	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004304	estrone sulfotransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0007586	digestion	NAS	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008202	steroid metabolic process	IEA	biological process
GO:0008202	steroid metabolic process	TAS	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030573	bile acid catabolic process	IEA	biological process
GO:0047704	bile-salt sulfotransferase activity	IEA	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004304	estrone sulfotransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007586	digestion	NAS	biological process
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008202	steroid metabolic process	TAS	biological process
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04976	Bile secretion
hsa05204	Chemical carcinogenesis

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 16617014
Cancer	GAD: 16617014
Cancer (breast)	GAD: 20214802
Autism	GAD: 19598235
Chronic renal failure	GAD: 21085059
Polycystic ovary syndrome (PCOS)	INFBASE: 1287208
Premature ovarian failure (POF)	INFBASE: 9286728
Polycystic ovary syndrome (PCOS)	MIK: 1287208
Cryptorchidism	MIK: 28606200
Polycystic ovary syndrome (PCOS)	MIK: 1287208
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
1287208	PCOS			30 (9 normal cycling women in the follicular phase, 10 normal cycling women in the luteal phase, 11 women with PCOS)	Femal infertility	LH DHEAS
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R