• Gene id: 6820

Gene Summary

• Gene Symbol: SULT2B1   Gene   UCSC   Ensembl
• Aliases: ARCI14, HSST2
• Gene name: sulfotransferase family 2B member 1
• Alternate names: sulfotransferase 2B1, ST2B1, alcohol sulfotransferase, hydroxysteroid sulfotransferase 2, hydroxysteroid sulfotransferase SULT2B1a, sulfotransferase family, cytosolic, 2B, member 1,
• Gene location: 19q13.33 (58467079: 58475435)     Exons: 5     NC_000019.10
• Gene summary(Entrez): Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and
• OMIM: 604125

Protein Summary

• Protein general information: O00204  
  • Name: Sulfotransferase 2B1 (EC 2.8.2.2) (Alcohol sulfotransferase) (Hydroxysteroid sulfotransferase 2) (Sulfotransferase family 2B member 1) (Sulfotransferase family cytosolic 2B member 1) (ST2B1)
  • Length: 365  
  • Mass: 41308
  • Tissue specificity: Expressed in the stratum granulosum-stratum corneum junction in the skin (at protein level) (PubMed
• Sequence:

  MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTW
  MIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKAKVIYMGRNPR
  DVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITYEELQQDLQGSVERIC
  GFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQ
  MRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETPHPRPS

• Structural information:
  • Interpro: IPR027417  IPR000863  
  • PDB: 1Q1Q 1Q1Z 1Q20 1Q22
  • PDBsum: 1Q1Q 1Q1Z 1Q20 1Q22
  • STRING: ENSP00000201586
• Other Databases: GeneCards:  SULT2B1  Malacards:  SULT2B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IDA	cellular component
GO:0008203	cholesterol metabolic process	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0045606	positive regulation of epidermal cell differentiation	IMP	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008202	steroid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0004027	alcohol sulfotransferase activity	IEA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0000103	sulfate assimilation	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003676	nucleic acid binding	IMP	molecular function
GO:1990239	steroid hormone binding	IMP	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	biological process
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0015485	cholesterol binding	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0008202	steroid metabolic process	IDA	biological process
GO:0008202	steroid metabolic process	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00140	Steroid hormone biosynthesis

Diseases

Associated diseases	References
Autosomal recessive congenital ichthyosis	KEGG:H00734
Autosomal recessive congenital ichthyosis	KEGG:H00734
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray