• Gene id: 6819

Gene Summary

• Gene Symbol: SULT1C2   Gene   UCSC   Ensembl
• Aliases: ST1C1, ST1C2, SULT1C1, humSULTC2
• Gene name: sulfotransferase family 1C member 2
• Alternate names: sulfotransferase 1C2, SULT1C#1, sulfotransferase 1C1, sulfotransferase family, cytosolic, 1C, member 1, sulfotransferase family, cytosolic, 1C, member 2,
• Gene location: 2q12.3 (108288894: 108309914)     Exons: 9     NC_000002.12
• Gene summary(Entrez): Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and
• OMIM: 602385

Protein Summary

• Protein general information: O00338  
  • Name: Sulfotransferase 1C2 (ST1C2) (EC 2.8.2. ) (Sulfotransferase 1C1) (SULT1C#1) (humSULTC2)
  • Length: 296  
  • Mass: 34880
  • Tissue specificity: Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.
• Sequence:

  MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAI
  IQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHML
  PDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIV
  QETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL

• Structural information:
  • Interpro: IPR027417  IPR000863  
  • PDB: 3BFX
  • PDBsum: 3BFX
  • STRING: ENSP00000319622
• Other Databases: GeneCards:  SULT1C2  Malacards:  SULT1C2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0009308	amine metabolic process	TAS	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0051923	sulfation	IDA	biological process
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0051923	sulfation	IEA	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0051923	sulfation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)