• Gene id: 6817

Gene Summary

• Gene Symbol: SULT1A1   Gene   UCSC   Ensembl
• Aliases: HAST1/HAST2, P-PST, PST, ST1A1, ST1A3, STP, STP1, TSPST1
• Gene name: sulfotransferase family 1A member 1
• Alternate names: sulfotransferase 1A1, P-PST 1, aryl sulfotransferase 1, phenol-sulfating phenol sulfotransferase 1, sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1, thermostable phenol sulfotransferase1, ts-PST,
• Gene location: 16p11.2 (28623585: 28605586)     Exons: 13     NC_000016.10
• Gene summary(Entrez): Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and
• OMIM: 171150

SNPs

rs1042157

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.28605736G>A
NC_000016.10   g.28605736G>C
NC_000016.9   g.28617057G>A
NC_000016.9   g.28617057G>C
NG_028128.1   g.22810C>T
NG_028128.1   g.22810C>G
NM_177536.3   c.*85C>T
NM_177536.3   c.*85C>G
NM_001055.3   c.*85C>T
NM_001055.3   c.*85C>G
NM_177534.2   c.

Protein Summary

• Protein general information: P50225  
  • Name: Sulfotransferase 1A1 (ST1A1) (EC 2.8.2.1) (Aryl sulfotransferase 1) (HAST1/HAST2) (Phenol sulfotransferase 1) (Phenol sulfating phenol sulfotransferase 1) (P PST 1) (ST1A3) (Thermostable phenol sulfotransferase) (Ts PST)
  • Length: 295  
  • Mass: 34,165
• Sequence:

  MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPI
  FMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHP
  EPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQ
  HTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

• Structural information:
  • Interpro: IPR027417  IPR000863  
  • PDB: 1LS6 1Z28 2D06 3QVU 3QVV 3U3J 3U3K 3U3M 3U3O 3U3R 4GRA
  • PDBsum: 1LS6 1Z28 2D06 3QVU 3QVV 3U3J 3U3K 3U3M 3U3O 3U3R 4GRA
  • STRING: ENSP00000321988
• Other Databases: GeneCards:  SULT1A1  Malacards:  SULT1A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004062	aryl sulfotransferase activity	IDA	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006584	catecholamine metabolic process	IEA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0009308	amine metabolic process	TAS	biological process
GO:0009812	flavonoid metabolic process	IDA	biological process
GO:0047894	flavonol 3-sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0004062	aryl sulfotransferase activity	IEA	molecular function
GO:0004062	aryl sulfotransferase activity	IDA	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006584	catecholamine metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008202	steroid metabolic process	IEA	biological process
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0009308	amine metabolic process	TAS	biological process
GO:0009812	flavonoid metabolic process	IDA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0047894	flavonol 3-sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0004062	aryl sulfotransferase activity	IDA	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0009308	amine metabolic process	TAS	biological process
GO:0009812	flavonoid metabolic process	IDA	biological process
GO:0047894	flavonol 3-sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05204	Chemical carcinogenesis

Diseases

Associated diseases	References
Cancer (lung)	GAD: 12469224
Cancer (ovarian)	GAD: 16284375
Cancer (Pancreatic ductal)	GAD: 18499698
Cancer (prostate)	GAD: 14973106
Cancer (Squamous cell)	GAD: 19126640
Cancer (stomach)	GAD: 16137826
Cancer (testicular)	GAD: 19776291
Cancer (urologic)	GAD: 19120511
Cancer (urothelial)	GAD: 12402313
Cancer	GAD: 18264785
Cancer (bladder)	GAD: 14643027
Cancer (brain)	GAD: 17605044
Cancer (colon)	GAD: 16926176
Cancer (colorectal)	GAD: 16006997
Cancer (endometrial)	GAD: 16402077
Cancer (esophageal)	GAD: 16272171
Cancer (head and neck)	GAD: 16575574
Cancer (leukemia)	GAD: 12468438
Cancer (breast)	GAD: 16103451
Cardiovascular disease	GAD: 18259693
Acute coronary syndrome	GAD: 18259693
Cleft defects	GAD: 20634891
Eye diseases	GAD: 18447907
Asthma	GAD: 19575027
Inflammatory bowel disease	GAD: 19915574
Obesity	GAD: 20734064
Chronic renal failure	GAD: 21085059
Male factor infertility	MIK: 26791536
Male infertility	MIK: 26791536
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26791536	Male infertility				Male infertility	caspase-3 (c3) PST
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)