• Gene id: 6810

Gene Summary

• Gene Symbol: STX4   Gene   UCSC   Ensembl
• Aliases: STX4A, p35-2
• Gene name: syntaxin 4
• Alternate names: syntaxin-4, renal carcinoma antigen NY-REN-31, syntaxin 4A (placental),
• Gene location: 16p11.2 (31033094: 31040167)     Exons: 13     NC_000016.10
• OMIM: 123831

Protein Summary

• Protein general information: Q12846  
  • Name: Syntaxin 4 (Renal carcinoma antigen NY REN 31)
  • Length: 297  
  • Mass: 34180
  • Tissue specificity: Expressed in neutrophils and neutrophil-differentiated HL-60 cells. Expression in neutrophils increases with differentiation. {ECO
• Sequence:

  MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLP
  EESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
  KNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHDIFT
  FLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG

• Structural information:
  • Protein Domains: (200..26-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR010989  IPR006012  IPR006011  IPR000727  
  • Prosite: PS00914 PS50192
  • CDD: cd00179
  • STRING: ENSP00000317714
• Other Databases: GeneCards:  STX4  Malacards:  STX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005773	vacuole	TAS	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0048787	presynaptic active zone membrane	IBA	cellular component
GO:0048278	vesicle docking	IBA	biological process
GO:0042734	presynaptic membrane	IBA	cellular component
GO:0031201	SNARE complex	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0006906	vesicle fusion	IBA	biological process
GO:0031629	synaptic vesicle fusion to presynaptic active zone membrane	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0006887	exocytosis	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0000149	SNARE binding	IBA	molecular function
GO:0031201	SNARE complex	IDA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006892	post-Golgi vesicle-mediated transport	TAS	biological process
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:1990668	vesicle fusion with endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membrane	TAS	biological process
GO:1990668	vesicle fusion with endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membrane	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0035749	myelin sheath adaxonal region	IEA	cellular component
GO:0035493	SNARE complex assembly	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000322	storage vacuole	IEA	cellular component
GO:0000149	SNARE binding	IEA	molecular function
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043219	lateral loop	IEA	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0036477	somatodendritic compartment	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0060291	long-term synaptic potentiation	IDA	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IDA	biological process
GO:0048284	organelle fusion	IDA	biological process
GO:0031201	SNARE complex	IDA	cellular component
GO:0042581	specific granule	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043197	dendritic spine	IDA	cellular component
GO:0045202	synapse	IDA	cellular component
GO:1903575	cornified envelope assembly	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:0016230	sphingomyelin phosphodiesterase activator activity	IMP	molecular function
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:2000010	positive regulation of protein localization to cell surface	IMP	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IMP	biological process
GO:0043311	positive regulation of eosinophil degranulation	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0050921	positive regulation of chemotaxis	IMP	biological process
GO:0017157	regulation of exocytosis	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	IMP	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IMP	biological process
GO:0043085	positive regulation of catalytic activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	IMP	biological process
GO:0098794	postsynapse	IMP	cellular component
GO:0098794	postsynapse	IDA	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04962	Vasopressin-regulated water reabsorption
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881