• Gene id: 6809

Gene Summary

• Gene Symbol: STX3   Gene   UCSC   Ensembl
• Aliases: STX3A
• Gene name: syntaxin 3
• Alternate names: syntaxin-3, syntaxin 3A,
• Gene location: 11q12.1 (167630192: 167708695)     Exons: 9     NC_000001.11
• Gene summary(Entrez): The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle f
• OMIM: 600876

Protein Summary

• Protein general information: Q13277  
  • Name: Syntaxin 3
  • Length: 289  
  • Mass: 33155
• Sequence:

  MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKD
  DLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQ
  RQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQ
  GEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILALIIGLSVGLN

• Structural information:
  • Protein Domains: (191..25-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR010989  IPR031186  IPR006012  IPR006011  IPR000727  
  • Prosite: PS00914 PS50192
  • CDD: cd00179
  • STRING: ENSP00000338562
• Other Databases: GeneCards:  STX3  Malacards:  STX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050544	arachidonic acid binding	ISS	molecular function
GO:0031175	neuron projection development	ISS	biological process
GO:0005773	vacuole	TAS	cellular component
GO:0031201	SNARE complex	ISS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0006906	vesicle fusion	IBA	biological process
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0031201	SNARE complex	IBA	cellular component
GO:0042734	presynaptic membrane	IBA	cellular component
GO:0048278	vesicle docking	IBA	biological process
GO:0048787	presynaptic active zone membrane	IBA	cellular component
GO:0098794	postsynapse	IBA	cellular component
GO:0000149	SNARE binding	IBA	molecular function
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006887	exocytosis	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0031629	synaptic vesicle fusion to presynaptic active zone membrane	IBA	biological process
GO:0098967	exocytic insertion of neurotransmitter receptor to postsynaptic membrane	IBA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016081	synaptic vesicle docking	IEA	biological process
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061025	membrane fusion	IEA	biological process
GO:0050544	arachidonic acid binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0031201	SNARE complex	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030141	secretory granule	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0099003	vesicle-mediated transport in synapse	IEA	biological process
GO:0098967	exocytic insertion of neurotransmitter receptor to postsynaptic membrane	IEA	biological process
GO:0042589	zymogen granule membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0042582	azurophil granule	IDA	cellular component
GO:0042581	specific granule	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050921	positive regulation of chemotaxis	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:2000010	positive regulation of protein localization to cell surface	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04721	Synaptic vesicle cycle
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq