• Gene id: 680

Gene Summary

• Gene Symbol: BRS3   Gene   UCSC   Ensembl
• Aliases: BB3, BB3R, BBR3
• Gene name: bombesin receptor subtype 3
• Alternate names: bombesin receptor subtype-3, BRS-3, G-protein coupled receptor, bombesin like receptor 3,
• Gene location: Xq26.3 (136487946: 136493779)     Exons: 17     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a G protein-coupled membrane receptor that binds bombesin-like peptides. This binding results in activation of a phosphatidylinositol-calcium second messenger system, with physiological effects including regulation of m
• OMIM: 300107

Protein Summary

• Protein general information: P32247  
  • Name: Bombesin receptor subtype 3 (BRS 3)
  • Length: 399  
  • Mass: 44411
  • Tissue specificity: In germ cells in testis. Lung carcinoma cells.
• Sequence:

  MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIKVFFKT
  KSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADRYKAVV
  KPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVF
  YIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT
  YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTG
  SIQMSEISVTSFTGCSVKQAEDRF

• Structural information:
  • Interpro: IPR001560  IPR001556  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000359682
• Other Databases: GeneCards:  BRS3  Malacards:  BRS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004946	bombesin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031989	bombesin receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004946	bombesin receptor activity	TAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0006006	glucose metabolic process	TAS	biological process
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0008343	adult feeding behavior	TAS	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)