• Gene id: 6799

Gene Summary

• Gene Symbol: SULT1A2   Gene   UCSC   Ensembl
• Aliases: HAST4, P-PST, P-PST 2, ST1A2, STP2, TSPST2
• Gene name: sulfotransferase family 1A member 2
• Alternate names: sulfotransferase 1A2, aryl sulfotransferase 2, arylamine sulfotransferase, phenol sulfotransferase 2, phenol-preferring phenol sulfotransferase2, phenol-sulfating phenol sulfotransferase 2, phenolic-metabolizing (P) form of PST, sulfotransferase family, cytosoli,
• Gene location: 16p11.2 (28597069: 28591942)     Exons: 8     NC_000016.10
• Gene summary(Entrez): Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and

Protein Summary

• Protein general information: P50226  
  • Name: Sulfotransferase 1A2 (ST1A2) (EC 2.8.2.1) (Aryl sulfotransferase 2) (Phenol sulfotransferase 2) (Phenol sulfating phenol sulfotransferase 2) (P PST 2)
  • Length: 295  
  • Mass: 34310
• Sequence:

  MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPI
  FMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYP
  HPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVE
  HTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSEL

• Structural information:
  • Interpro: IPR027417  IPR000863  
  • PDB: 1Z29
  • PDBsum: 1Z29
  • STRING: ENSP00000378992
• Other Databases: GeneCards:  SULT1A2  Malacards:  SULT1A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0004062	aryl sulfotransferase activity	IDA	molecular function
GO:0018958	phenol-containing compound metabolic process	IDA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0006584	catecholamine metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008202	steroid metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0009309	amine biosynthetic process	TAS	biological process
GO:0004062	aryl sulfotransferase activity	IEA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0047894	flavonol 3-sulfotransferase activity	IDA	molecular function
GO:0051923	sulfation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006068	ethanol catabolic process	IDA	biological process
GO:0004062	aryl sulfotransferase activity	IDA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	biological process
GO:0051923	sulfation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05204	Chemical carcinogenesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881