• Gene id: 6795

Gene Summary

• Gene Symbol: AURKC   Gene   UCSC   Ensembl
• Aliases: AIE2, AIK3, ARK3, AurC, HEL-S-90, SPGF5, STK13, aurora-C
• Gene name: aurora kinase C
• Alternate names: aurora kinase C, ARK-3, aurora 3, aurora-related kinase 3, aurora/IPL1-related kinase 3, aurora/IPL1/EG2 protein 2, epididymis secretory protein Li 90, serine/threonine kinase 13 (aurora/IPL1-like), serine/threonine-protein kinase 13, serine/threonine-pro,
• Gene location: 19q13.43 (57230316: 57235549)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules
• OMIM: 603495

SNPs

rs397515484

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.57233458A>G
NC_000019.9   g.57744826A>G
NG_012134.1   g.7450A>G|SEQ=[A/G]|GENE=AURKC

Protein Summary

• Protein general information: Q9UQB9  
  • Name: Aurora kinase C (EC 2.7.11.1) (Aurora 3) (Aurora/IPL1 related kinase 3) (ARK 3) (Aurora related kinase 3) (Aurora/IPL1/Eg2 protein 2) (Serine/threonine protein kinase 13) (Serine/threonine protein kinase aurora C)
  • Length: 309  
  • Mass: 35,591
  • Tissue specificity: Abundant in the testis. {ECO
• Sequence:

  MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLF
  KSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEEL
  ADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCI
  GVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
  LPPCAQMAS

• Structural information:
  • Protein Domains: Protein (43-293)
  • Interpro: IPR030616  IPR030613  IPR011009  IPR000719  IPR017441   IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000302898
• Other Databases: GeneCards:  AURKC  Malacards:  AURKC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000780	condensed nuclear chromosome, centromeric region	IBA	cellular component
GO:0000793	condensed chromosome	IDA	cellular component
GO:0000910	cytokinesis	IEA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004712	protein serine/threonine/tyrosine kinase activity	TAS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005819	spindle	TAS	cellular component
GO:0005876	spindle microtubule	IBA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008608	attachment of spindle microtubules to kinetochore	TAS	biological process
GO:0016570	histone modification	TAS	biological process
GO:0030496	midbody	IDA	cellular component
GO:0030496	midbody	TAS	cellular component
GO:0031616	spindle pole centrosome	IBA	cellular component
GO:0032133	chromosome passenger complex	TAS	cellular component
GO:0032467	positive regulation of cytokinesis	TAS	biological process
GO:0035174	histone serine kinase activity	IBA	molecular function
GO:0035404	histone-serine phosphorylation	IEA	biological process
GO:0048599	oocyte development	IEA	biological process
GO:0051233	spindle midzone	IDA	cellular component
GO:0051256	mitotic spindle midzone assembly	TAS	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IBA	cellular component
GO:0000793	condensed chromosome	IDA	cellular component
GO:0000910	cytokinesis	IEA	biological process
GO:0000910	cytokinesis	TAS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004712	protein serine/threonine/tyrosine kinase activity	TAS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005819	spindle	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005876	spindle microtubule	IBA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008608	attachment of spindle microtubules to kinetochore	TAS	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016570	histone modification	TAS	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0030496	midbody	TAS	cellular component
GO:0031616	spindle pole centrosome	IBA	cellular component
GO:0032133	chromosome passenger complex	IEA	cellular component
GO:0032133	chromosome passenger complex	TAS	cellular component
GO:0032467	positive regulation of cytokinesis	TAS	biological process
GO:0035174	histone serine kinase activity	IBA	molecular function
GO:0035404	histone-serine phosphorylation	IEA	biological process
GO:0048599	oocyte development	IEA	biological process
GO:0051233	spindle midzone	IDA	cellular component
GO:0051255	spindle midzone assembly	IEA	biological process
GO:0051256	mitotic spindle midzone assembly	TAS	biological process
GO:0051301	cell division	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0000780	condensed nuclear chromosome, centromeric region	IBA	cellular component
GO:0000793	condensed chromosome	IDA	cellular component
GO:0000910	cytokinesis	TAS	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004712	protein serine/threonine/tyrosine kinase activity	TAS	molecular function
GO:0005819	spindle	TAS	cellular component
GO:0005876	spindle microtubule	IBA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0008608	attachment of spindle microtubules to kinetochore	TAS	biological process
GO:0016570	histone modification	TAS	biological process
GO:0030496	midbody	IDA	cellular component
GO:0030496	midbody	TAS	cellular component
GO:0031616	spindle pole centrosome	IBA	cellular component
GO:0032133	chromosome passenger complex	TAS	cellular component
GO:0032467	positive regulation of cytokinesis	TAS	biological process
GO:0035174	histone serine kinase activity	IBA	molecular function
GO:0051233	spindle midzone	IDA	cellular component
GO:0051256	mitotic spindle midzone assembly	TAS	biological process

Diseases

Associated diseases	References
Cancer (breast)	GAD: 20508983
Recurrent pregnancy loss (RPL)	INFBASE: 23273756
Spermatogenesis defects	KEGG: H01282
Globozoospermia	MIK: 26418511
Male factor infertility	MIK: 24484996
Sperm macrocephaly	MIK: 23273756
Macrozoospermia	MIK: 25219909
Globozoospermia	MIK: 26418511
Macrozoospermia	MIK: 25219909
Male infertility	MIK: 26341096
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24484996	Infertility	c.144delC	Morocca n	326 idiopathic infertile patients, 450 controls	Male infertility
22888167	Infertility	p.Y248*, c.144delC	North A frican origin, Europe an, Mag hrebian	200 controls (100 French donors from North Africa, 100 French donors from Europe), 87 patients (44 from France, 30 from Tunisia, 9 from Morocco, 4 from Algeria)	Male infertility
21733974	Infertility	c.144delC, c.436-2A>G	Tunisia n (Pati ent), N orth Af rica (C ontrol)	2 patients	Male infertility
21353399	Infertility	c.144delC	Morocco n	18 infertile patients	Male infertility
19447663	Infertility	c.144delC	North A frican	62 patients	Male infertility
19147683	Infertility	c.144delC	North A frican	62 patients	Male infertility
17435757	Infertility	single nucleotide deletion in the AURKC coding sequence		10 infertile	Male infertility
26418511	Globozoospermia				Male infertility	AURKC DPY19L2
25219909	Macrozoospermia, male infertility	c.114delC, p.Y248*		599 consecutive patients consulting for couple infertility	Male infertility
26341096	Macrozoospermia, male infertility	c.144delC	Tunisia n	6902 (33 macrozoospermic patients among 6652 infertile men, 250 unrelated control individuals)	Male infertility
30594972	Macrozoospermia, Male infertiltiy	c.269G>A	Chinese	1 petient with macrozooapermia	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray