• Gene id: 6788

Gene Summary

• Gene Symbol: STK3   Gene   UCSC   Ensembl
• Aliases: KRS1, MST2
• Gene name: serine/threonine kinase 3
• Alternate names: serine/threonine-protein kinase 3, KB-1458E12.1, MST-2, STE20-like kinase MST2, epididymis secretory sperm binding protein, mammalian STE20-like protein kinase 2, serine/threonine kinase 3 (STE20 homolog, yeast), serine/threonine kinase 3 (Ste20, yeast homolog), ,
• Gene location: 8q22.2 (32178107: 32168211)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene encodes a serine/threonine protein kinase activated by proapoptotic molecules indicating the encoded protein functions as a growth suppressor. Cleavage of the protein product by caspase removes the inhibitory C-terminal portion. The N-terminal p
• OMIM: 605030

Protein Summary

• Protein general information: Q13188  
  • Name: Serine/threonine protein kinase 3 (EC 2.7.11.1) (Mammalian STE20 like protein kinase 2) (MST 2) (STE20 like kinase MST2) (Serine/threonine protein kinase Krs 1) [Cleaved into: Serine/threonine protein kinase 3 36kDa subunit (MST2/N); Serine/threonine prot
  • Length: 491  
  • Mass: 56301
  • Tissue specificity: Expressed at high levels in adult kidney, skeletal and placenta tissues and at very low levels in adult heart, lung and brain tissues. {ECO
• Sequence:

  MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQ
  QCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAG
  NILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIH
  PMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
  RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEE
  DGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQM
  RLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF

• Structural information:
  • Protein Domains: (27..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (437..48-)
    (/note="SARAH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00310"-)
  • Interpro: IPR011009  IPR024205  IPR000719  IPR017441  IPR011524  
  • Prosite: PS00107 PS50011 PS50951
  • PDB: 3WWS 4HKD 4L0N 4LG4 4LGD 4OH9 5BRM 5DH3 6AO5 6AR2
  • PDBsum: 3WWS 4HKD 4L0N 4LG4 4LGD 4OH9 5BRM 5DH3 6AO5 6AR2
  • DIP: 36128
  • STRING: ENSP00000429744
• Other Databases: GeneCards:  STK3  Malacards:  STK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0035329	hippo signaling	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IGI	biological process
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0035329	hippo signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902043	positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0097284	hepatocyte apoptotic process	IEA	biological process
GO:0060800	regulation of cell differentiation involved in embryonic placenta development	IEA	biological process
GO:0060215	primitive hemopoiesis	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0035329	hippo signaling	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007417	central nervous system development	IEA	biological process
GO:0003157	endocardium development	IEA	biological process
GO:0001841	neural tube formation	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0060706	cell differentiation involved in embryonic placenta development	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0046621	negative regulation of organ growth	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0043539	protein serine/threonine kinase activator activity	TAS	molecular function
GO:0035329	hippo signaling	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0043065	positive regulation of apoptotic process	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04390	Hippo signaling pathway
hsa04392	Hippo signaling pathway - multiple species

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R