• Gene id: 6787

Gene Summary

• Gene Symbol: NEK4   Gene   UCSC   Ensembl
• Aliases: NRK2, STK2, pp12301
• Gene name: NIMA related kinase 4
• Alternate names: serine/threonine-protein kinase Nek4, NIMA (never in mitosis gene a)-related kinase 4, never in mitosis A-related kinase 4, nimA-related protein kinase 4, serine/threonine kinase 2, serine/threonine protein kinase-2, serine/threonine-protein kinase NRK2, serine/,
• Gene location: 3p21.1 (52770948: 52708443)     Exons: 19     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a serine/threonine protein kinase required for normal entry into replicative senescence. The encoded protein also is involved in cell cycle arrest in response to double-stranded DNA damage. Finally, this protein plays a
• OMIM: 601959

Protein Summary

• Protein general information: P51957  
  • Name: Serine/threonine protein kinase Nek4 (EC 2.7.11.1) (Never in mitosis A related kinase 4) (NimA related protein kinase 4) (Serine/threonine protein kinase 2) (Serine/threonine protein kinase NRK2)
  • Length: 841  
  • Mass: 94597
  • Tissue specificity: Highest expression in adult heart, followed by pancreas, skeletal muscle, brain, testis, retina, liver, kidney, lung and placenta. Present in most primary carcinomas. {ECO
• Sequence:

  MPLAAYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGG
  DGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDL
  GIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPP
  MPRDYSPELAELIRTMLSKRPEERPSVRSILRQPYIKRQISFFLEATKIKTSKNNIKNGDSQSKPFATVVSGEAE
  SNHEVIHPQPLSSEGSQTYIMGEGKCLSQEKPRASGLLKSPASLKAHTCKQDLSNTTELATISSVNIDILPAKGR
  DSVSDGFVQENQPRYLDASNELGGICSISQVEEEMLQDNTKSSAQPENLIPMWSSDIVTGEKNEPVKPLQPLIKE
  QKPKDQSLALSPKLECSGTILAHSNLRLLGSSDSPASASRVAGITGVCHHAQDQVAGECIIEKQGRIHPDLQPHN
  SGSEPSLSRQRRQKRREQTEHRGEKRQVRRDLFAFQESPPRFLPSHPIVGKVDVTSTQKEAENQRRVVTGSVSSS
  RSSEMSSSKDRPLSARERRRLKQSQEEMSSSGPSVRKASLSVAGPGKPQEEDQPLPARRLSSDCSVTQERKQIHC
  LSEDELSSSTSSTDKSDGDYGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHG
  KVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVRLREHMGEKYTTY
  SVKARQLKFFEENMNF

• Structural information:
  • Protein Domains: (6..26-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000233027
• Other Databases: GeneCards:  NEK4  Malacards:  NEK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001020	regulation of response to DNA damage stimulus	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:1900062	regulation of replicative cell aging	IMP	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0030145	manganese ion binding	ISS	molecular function
GO:0000278	mitotic cell cycle	IMP	biological process
GO:1900062	regulation of replicative cell aging	IMP	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:2000772	regulation of cellular senescence	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0097014	ciliary plasm	IEA	cellular component
GO:0036064	ciliary basal body	IEA	cellular component
GO:0035869	ciliary transition zone	IEA	cellular component
GO:0035253	ciliary rootlet	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq