• Gene id: 6783

Gene Summary

• Gene Symbol: SULT1E1   Gene   UCSC   Ensembl
• Aliases: EST, EST-1, ST1E1, STE
• Gene name: sulfotransferase family 1E member 1
• Alternate names: estrogen sulfotransferase, estrone sulfotransferase, sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, sulfotransferase, estrogen-preferring,
• Gene location: 4q13.3 (69860151: 69841211)     Exons: 9     NC_000004.12
• Gene summary(Entrez): Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and
• OMIM: 600043

SNPs

rs3736599

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000004.12   g.69860103C>T
NC_000004.11   g.70725821C>T
NM_005420.3   c.-64G>A
NM_005420.2   c.-64G>A
XM_011532210.2   c.-64G>A|SEQ=[C/T]|GENE=SULT1E1

Protein Summary

• Protein general information: P49888  
  • Name: Estrogen sulfotransferase (EC 2.8.2.4) (EST 1) (Sulfotransferase 1E1) (ST1E1) (Sulfotransferase, estrogen preferring)
  • Length: 294  
  • Mass: 35,126
• Sequence:

  MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIF
  NRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPN
  PGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHH
  TSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

• Structural information:
  • Interpro: IPR027417  IPR000863  
  • PDB: 1G3M 1HY3 4JVL 4JVM 4JVN
  • PDBsum: 1G3M 1HY3 4JVL 4JVM 4JVN
  • STRING: ENSP00000226444
• Other Databases: GeneCards:  SULT1E1  Malacards:  SULT1E1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004304	estrone sulfotransferase activity	TAS	molecular function
GO:0005496	steroid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008202	steroid metabolic process	TAS	biological process
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0045600	positive regulation of fat cell differentiation	IMP	biological process
GO:0047894	flavonol 3-sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004304	estrone sulfotransferase activity	IEA	molecular function
GO:0004304	estrone sulfotransferase activity	TAS	molecular function
GO:0004304	estrone sulfotransferase activity	TAS	molecular function
GO:0005496	steroid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008202	steroid metabolic process	TAS	biological process
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0045600	positive regulation of fat cell differentiation	IMP	biological process
GO:0047894	flavonol 3-sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004062	aryl sulfotransferase activity	TAS	molecular function
GO:0004304	estrone sulfotransferase activity	TAS	molecular function
GO:0004304	estrone sulfotransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0008202	steroid metabolic process	TAS	biological process
GO:0008210	estrogen metabolic process	IDA	biological process
GO:0045600	positive regulation of fat cell differentiation	IMP	biological process
GO:0047894	flavonol 3-sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	IDA	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050294	steroid sulfotransferase activity	TAS	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0051923	sulfation	IDA	biological process
GO:0051923	sulfation	IDA	biological process

Diseases

Associated diseases	References
Cancer	GAD: 18318428
Cancer (endometrial)	GAD: 20381444
Cancer (testicular)	GAD: 19776291
Cancer (breast)	GAD: 15894657
Bone diseases	GAD: 16969590
Oligozoospermia	MIK: 2036048
Male factor infertility	MIK: 2036048
Azoospermia	MIK: 2036048
Chronic renal failure	GAD: 21085059
Azoospermia	MIK: 2036048
Oligozoopsermia	MIK: 2036048
Male infertility	MIK: 2036048
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
2036048	Azoospermia, oligozoopsermia, male infertility			79 men, including fertile volunteers, vasectomized subjects, and patients with oligozoospermia and secretory azoospermia	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray