• Gene id: 6782

Gene Summary

• Gene Symbol: HSPA13   Gene   UCSC   Ensembl
• Aliases: STCH
• Gene name: heat shock protein family A (Hsp70) member 13
• Alternate names: heat shock 70 kDa protein 13, heat shock protein 70kDa family, member 13, microsomal stress 70 protein ATPase core, stress 70 protein chaperone, microsome-associated, 60kD, stress 70 protein chaperone, microsome-associated, 60kDa, stress-70 protein chaperone m,
• Gene location: 21q11.2 (14383145: 14371114)     Exons: 5     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the heat shock protein 70 family and is found associated with microsomes. Members of this protein family play a role in the processing of cytosolic and secretory proteins, as well as in the removal of denatu
• OMIM: 601100

Protein Summary

• Protein general information: P48723  
  • Name: Heat shock 70 kDa protein 13 (Microsomal stress 70 protein ATPase core) (Stress 70 protein chaperone microsome associated 60 kDa protein)
  • Length: 471  
  • Mass: 51927
  • Tissue specificity: Constitutively expressed in all tissues.
• Sequence:

  MAREMTILGSAVLTLLLAGYLAQQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTD
  NDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETITVSPEYVGSR
  LLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVID
  LGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLT
  LHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNE
  DLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGS
  WPLQVSALEIPNKHLQKTNFN

• Structural information:
  • Interpro: IPR018181  IPR013126  IPR042048  
  • Prosite: PS00297 PS00329 PS01036
  • CDD: cd10237
  • STRING: ENSP00000285667
• Other Databases: GeneCards:  HSPA13  Malacards:  HSPA13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051787	misfolded protein binding	IBA	molecular function
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0006986	response to unfolded protein	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005524	ATP binding	IBA	molecular function
GO:0044183	protein folding chaperone	IBA	molecular function
GO:0042026	protein refolding	IBA	biological process
GO:0034620	cellular response to unfolded protein	IBA	biological process
GO:0031072	heat shock protein binding	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881