• Gene id: 6780

Gene Summary

• Gene Symbol: STAU1   Gene   UCSC   Ensembl
• Aliases: PPP1R150, STAU
• Gene name: staufen double-stranded RNA binding protein 1
• Alternate names: double-stranded RNA-binding protein Staufen homolog 1, protein phosphatase 1, regulatory subunit 150, staufen, RNA binding protein, homolog 1,
• Gene location: 20q13.13 (49219294: 49113338)     Exons: 19     NC_000020.11
• Gene summary(Entrez): Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple
• OMIM: 601716

Protein Summary

• Protein general information: O95793  
  • Name: Double stranded RNA binding protein Staufen homolog 1
  • Length: 577  
  • Mass: 63182
  • Tissue specificity: Widely expressed. Expressed in brain, pancreas, heart, skeletal muscles, liver, lung, kidney and placenta.
• Sequence:

  MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTV
  ELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKH
  DAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEF
  VGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKE
  KEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQPTKPALKSEEKTPIK
  KPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPMVPEVAQAVGVSQGHHTKDFTRAAPNPAKAT
  VTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSS
  QPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC

• Structural information:
  • Protein Domains: (72..16-)
    (/note="DRBM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (184..25-)
    (/note="DRBM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (286..35-)
    (/note="DRBM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266"-)
  • Interpro: IPR014720  IPR032478  
  • Prosite: PS50137
  • CDD: cd00048
  • PDB: 4DKK 6HTU 6SDW 6SDY
  • PDBsum: 4DKK 6HTU 6SDW 6SDY
  • STRING: ENSP00000360922
• Other Databases: GeneCards:  STAU1  Malacards:  STAU1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0030425	dendrite	IDA	cellular component
GO:0044297	cell body	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003725	double-stranded RNA binding	TAS	molecular function
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0005791	rough endoplasmic reticulum	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0046726	positive regulation by virus of viral protein levels in host cell	IMP	biological process
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099010	modification of postsynaptic structure	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0008157	protein phosphatase 1 binding	IEA	molecular function
GO:1900273	positive regulation of long-term synaptic potentiation	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq