• Gene id: 678

Gene Summary

• Gene Symbol: ZFP36L2   Gene   UCSC   Ensembl
• Aliases: BRF2, ERF-2, ERF2, RNF162C, TIS11D
• Gene name: ZFP36 ring finger protein like 2
• Alternate names: mRNA decay activator protein ZFP36L2, EGF-response factor 2, TPA-induced sequence 11d, ZFP36-like 2, butyrate response factor 2, zinc finger protein 36, C3H type-like 1, zinc finger protein 36, C3H type-like 2, zinc finger protein 36, C3H1 type-like 2, zinc finge,
• Gene location: 2p21 (43226605: 43222401)     Exons: 2     NC_000002.12
• Gene summary(Entrez): This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with
• OMIM: 612053

SNPs

rs3736599

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000004.12   g.69860103C>T
NC_000004.11   g.70725821C>T
NM_005420.3   c.-64G>A
NM_005420.2   c.-64G>A
XM_011532210.2   c.-64G>A|SEQ=[C/T]|GENE=SULT1E1

rs2999052

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000003.12   g.128173194T>C
NC_000003.11   g.127892037T>C
NW_019805490.1   g.42304C>T|SEQ=[T/C]|GENE=EEFSEC

Protein Summary

• Protein general information: P47974  
  • Name: mRNA decay activator protein ZFP36L2 (Butyrate response factor 2) (EGF response factor 2) (ERF 2) (TPA induced sequence 11d) (Zinc finger protein 36, C3H1 type like 2) (ZFP36 like 2)
  • Length: 494  
  • Mass: 51063
  • Tissue specificity: Expressed mainly in the basal epidermal layer, weakly in the suprabasal epidermal layers (PubMed
• Sequence:

  MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPSPGSCS
  PKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFRDRSFSENGDRSQHLLHLQQQQKGGGGSQIN
  STRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAP
  SGGASGDLRAFGTRDALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCS
  SSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPCAACSSASCANNAFAFGPELSSLITP
  LAIQTHNFAAVAAAAYYRSQQQQQQQGLAPPAQPPAPPSATLPAGAAAPPSPPFSFQLPRRLSDSPVFDAPPSPP
  DSLSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLSISDD

• Structural information:
  • Interpro: IPR007635  IPR000571  IPR036855  
  • Prosite: PS50103
  • PDB: 1RGO
  • PDBsum: 1RGO
  • STRING: ENSP00000282388
• Other Databases: GeneCards:  ZFP36L2  Malacards:  ZFP36L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0097011	cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0009611	response to wounding	IDA	biological process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0071364	cellular response to epidermal growth factor stimulus	IDA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IDA	biological process
GO:2000737	negative regulation of stem cell differentiation	ISS	biological process
GO:0060216	definitive hemopoiesis	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0043488	regulation of mRNA stability	ISS	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	ISS	biological process
GO:0048103	somatic stem cell division	ISS	biological process
GO:0035019	somatic stem cell population maintenance	ISS	biological process
GO:0030097	hemopoiesis	ISS	biological process
GO:0006402	mRNA catabolic process	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0061158	3'-UTR-mediated mRNA destabilization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0033077	T cell differentiation in thymus	ISS	biological process
GO:1901991	negative regulation of mitotic cell cycle phase transition	ISS	biological process
GO:0045577	regulation of B cell differentiation	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:2000737	negative regulation of stem cell differentiation	IEA	biological process
GO:0060216	definitive hemopoiesis	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IEA	biological process
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IEA	molecular function
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IEA	biological process
GO:1901991	negative regulation of mitotic cell cycle phase transition	IEA	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IEA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IEA	biological process
GO:0048103	somatic stem cell division	IEA	biological process
GO:0045577	regulation of B cell differentiation	IEA	biological process
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0030097	hemopoiesis	IEA	biological process
GO:0006402	mRNA catabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881