• Gene id: 6779

Gene Summary

• Gene Symbol: STATH   Gene   UCSC   Ensembl
• Aliases: STR
• Gene name: statherin
• Alternate names: statherin,
• Gene location: 4q13.3 (69995965: 70002569)     Exons: 13     NC_000004.12
• OMIM: 184470

Protein Summary

• Protein general information: P02808  
  • Name: Statherin
  • Length: 62  
  • Mass: 7304
  • Tissue specificity: Secreted by parotid and submandibular glands.
• Sequence:

  MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF

• Structural information:
  • Interpro: IPR030773  IPR005575  
  • STRING: ENSP00000246895
• Other Databases: GeneCards:  STATH  Malacards:  STATH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0030500	regulation of bone mineralization	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0046848	hydroxyapatite binding	IEA	molecular function
GO:0031214	biomineral tissue development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001503	ossification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046541	saliva secretion	NAS	biological process
GO:0030345	structural constituent of tooth enamel	NAS	molecular function
GO:0030197	extracellular matrix constituent, lubricant activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030502	negative regulation of bone mineralization	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0046848	hydroxyapatite binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)